Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

S9W455

Protein Details
Accession S9W455    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
42-62SYTTSFKTKERKKKIMTEFDSHydrophilic
NLS Segment(s)
Subcellular Location(s) plas 25
Family & Domain DBs
InterPro View protein in InterPro  
IPR009340  DUF999  
Gene Ontology GO:0016020  C:membrane  
Pfam View protein in Pfam  
PF06198  DUF999  
Amino Acid Sequences MSENELKFDLSDPPAYSHANVYNVDLEKGLPLYKPKDIKKLSYTTSFKTKERKKKIMTEFDSFNGFFTDFRKNIDHYFPENVVVKSKWRFFSLIFVLSLLCTLAISYRFNFLPWLLTVSIEKGYGQALPSGIFLVIWAIFFALFCALIWPFILTVRIAAKVIIFIVVGLGNGLAWFVGAIFWGFYNILVFFLGMEFER
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.26
2 0.27
3 0.26
4 0.25
5 0.26
6 0.26
7 0.25
8 0.24
9 0.27
10 0.26
11 0.26
12 0.22
13 0.18
14 0.16
15 0.16
16 0.15
17 0.11
18 0.16
19 0.19
20 0.25
21 0.33
22 0.37
23 0.46
24 0.49
25 0.53
26 0.55
27 0.58
28 0.55
29 0.57
30 0.56
31 0.5
32 0.57
33 0.54
34 0.51
35 0.55
36 0.61
37 0.62
38 0.69
39 0.74
40 0.71
41 0.78
42 0.83
43 0.84
44 0.79
45 0.73
46 0.65
47 0.57
48 0.53
49 0.43
50 0.34
51 0.24
52 0.18
53 0.14
54 0.13
55 0.19
56 0.16
57 0.19
58 0.2
59 0.21
60 0.24
61 0.28
62 0.29
63 0.25
64 0.28
65 0.25
66 0.26
67 0.27
68 0.24
69 0.23
70 0.2
71 0.21
72 0.22
73 0.26
74 0.24
75 0.23
76 0.24
77 0.22
78 0.27
79 0.26
80 0.23
81 0.19
82 0.17
83 0.16
84 0.14
85 0.14
86 0.07
87 0.05
88 0.03
89 0.03
90 0.04
91 0.05
92 0.06
93 0.07
94 0.09
95 0.09
96 0.1
97 0.1
98 0.1
99 0.1
100 0.09
101 0.12
102 0.1
103 0.1
104 0.1
105 0.11
106 0.11
107 0.1
108 0.09
109 0.07
110 0.07
111 0.07
112 0.08
113 0.07
114 0.07
115 0.07
116 0.07
117 0.08
118 0.07
119 0.06
120 0.05
121 0.05
122 0.05
123 0.04
124 0.04
125 0.04
126 0.04
127 0.04
128 0.04
129 0.04
130 0.04
131 0.04
132 0.05
133 0.05
134 0.06
135 0.06
136 0.06
137 0.06
138 0.07
139 0.08
140 0.06
141 0.08
142 0.1
143 0.11
144 0.1
145 0.1
146 0.1
147 0.1
148 0.1
149 0.08
150 0.06
151 0.05
152 0.06
153 0.06
154 0.05
155 0.05
156 0.04
157 0.04
158 0.04
159 0.04
160 0.03
161 0.02
162 0.02
163 0.02
164 0.03
165 0.03
166 0.04
167 0.04
168 0.04
169 0.06
170 0.06
171 0.06
172 0.08
173 0.08
174 0.08
175 0.08
176 0.08
177 0.07
178 0.07