Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

S9VZ42

Protein Details
Accession S9VZ42    Localization Confidence Medium Confidence Score 11.4
NoLS Segment(s)
PositionSequenceProtein Nature
13-40KVKSQCPKVEKQEKPKQPKGRAHKRLVYBasic
NLS Segment(s)
PositionSequence
22-37EKQEKPKQPKGRAHKR
Subcellular Location(s) nucl 12.5, cyto_nucl 9.5, mito 9, cyto 5.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR006846  Ribosomal_S30  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF04758  Ribosomal_S30  
Amino Acid Sequences MGKVHGSLARAGKVKSQCPKVEKQEKPKQPKGRAHKRLVYVRRFVNVTNMAGGKRRMNPSS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.41
2 0.44
3 0.48
4 0.49
5 0.52
6 0.59
7 0.63
8 0.68
9 0.69
10 0.71
11 0.74
12 0.77
13 0.81
14 0.83
15 0.82
16 0.8
17 0.81
18 0.82
19 0.83
20 0.83
21 0.8
22 0.77
23 0.75
24 0.75
25 0.75
26 0.71
27 0.65
28 0.58
29 0.54
30 0.5
31 0.43
32 0.41
33 0.36
34 0.3
35 0.28
36 0.27
37 0.25
38 0.27
39 0.3
40 0.28
41 0.32