Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

S9VMK4

Protein Details
Accession S9VMK4   
Localization Confidence Low
Confidence Score 9.6
NoLS Segment(s)
PositionSequenceProtein Nature
84-110AEFRWGYSARRRIRKQREEYFKNQNKSHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 17.5, cyto_nucl 13, cyto 7.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR011431  Trafficking_Pga2  
Pfam View protein in Pfam  
PF07543  PGA2  
Amino Acid Sequences MNIDFTGYLQSYTIKDWIRICIYICGYLLLRPYLMKIGEKLQEKDHKRSEEQGYVDPQMTHGRTEKFHGEFDTDDEDEKENPDAEFRWGYSARRRIRKQREEYFKNQNKSPLDAYTEDDNDADIQEHLQD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.18
2 0.22
3 0.23
4 0.28
5 0.29
6 0.3
7 0.29
8 0.29
9 0.29
10 0.27
11 0.26
12 0.22
13 0.19
14 0.19
15 0.19
16 0.14
17 0.13
18 0.11
19 0.12
20 0.13
21 0.14
22 0.14
23 0.13
24 0.17
25 0.23
26 0.27
27 0.28
28 0.32
29 0.39
30 0.43
31 0.49
32 0.52
33 0.5
34 0.48
35 0.53
36 0.51
37 0.48
38 0.45
39 0.41
40 0.36
41 0.33
42 0.32
43 0.25
44 0.21
45 0.2
46 0.18
47 0.16
48 0.16
49 0.16
50 0.16
51 0.19
52 0.22
53 0.2
54 0.2
55 0.19
56 0.18
57 0.17
58 0.18
59 0.19
60 0.14
61 0.13
62 0.13
63 0.14
64 0.12
65 0.13
66 0.12
67 0.09
68 0.09
69 0.1
70 0.09
71 0.11
72 0.12
73 0.11
74 0.15
75 0.16
76 0.19
77 0.26
78 0.35
79 0.4
80 0.49
81 0.57
82 0.63
83 0.73
84 0.81
85 0.82
86 0.84
87 0.86
88 0.84
89 0.84
90 0.85
91 0.83
92 0.77
93 0.71
94 0.68
95 0.6
96 0.57
97 0.52
98 0.44
99 0.4
100 0.36
101 0.37
102 0.35
103 0.34
104 0.3
105 0.26
106 0.24
107 0.19
108 0.18
109 0.15
110 0.09