Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

B0DAZ0

Protein Details
Accession B0DAZ0    Localization Confidence Medium Confidence Score 13.1
NoLS Segment(s)
PositionSequenceProtein Nature
71-108NPNRGQESKPRKPKEPKAPKEKAPAKPRTKKTAPKSSKBasic
NLS Segment(s)
PositionSequence
77-106ESKPRKPKEPKAPKEKAPAKPRTKKTAPKS
Subcellular Location(s) nucl 19.5, cyto_nucl 13, cyto 5.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR009071  HMG_box_dom  
IPR036910  HMG_box_dom_sf  
Gene Ontology GO:0005634  C:nucleus  
GO:0003677  F:DNA binding  
KEGG lbc:LACBIDRAFT_297819  -  
PROSITE View protein in PROSITE  
PS50118  HMG_BOX_2  
CDD cd00084  HMG-box_SF  
Amino Acid Sequences MAKTATETKTKAATKAANTKTRAKVDKPKREPTAYQIFCKEHMKKWNEANPGRAKEAMTQIALMWKDAPENPNRGQESKPRKPKEPKAPKEKAPAKPRTKKTAPKSSKVSEEEEAVEDDEEPQASGSDD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.43
2 0.52
3 0.56
4 0.56
5 0.58
6 0.64
7 0.65
8 0.68
9 0.66
10 0.63
11 0.65
12 0.69
13 0.76
14 0.76
15 0.78
16 0.76
17 0.76
18 0.71
19 0.67
20 0.68
21 0.6
22 0.55
23 0.51
24 0.45
25 0.42
26 0.48
27 0.44
28 0.39
29 0.44
30 0.45
31 0.44
32 0.51
33 0.55
34 0.56
35 0.55
36 0.56
37 0.55
38 0.54
39 0.5
40 0.43
41 0.37
42 0.31
43 0.32
44 0.26
45 0.18
46 0.16
47 0.14
48 0.16
49 0.15
50 0.13
51 0.09
52 0.08
53 0.08
54 0.1
55 0.12
56 0.12
57 0.16
58 0.18
59 0.25
60 0.27
61 0.27
62 0.28
63 0.35
64 0.43
65 0.48
66 0.57
67 0.55
68 0.62
69 0.7
70 0.78
71 0.81
72 0.82
73 0.81
74 0.82
75 0.85
76 0.82
77 0.83
78 0.82
79 0.8
80 0.79
81 0.8
82 0.79
83 0.82
84 0.83
85 0.82
86 0.82
87 0.83
88 0.82
89 0.83
90 0.8
91 0.78
92 0.79
93 0.75
94 0.74
95 0.68
96 0.63
97 0.54
98 0.49
99 0.42
100 0.36
101 0.32
102 0.24
103 0.2
104 0.15
105 0.14
106 0.12
107 0.11
108 0.09
109 0.08