Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

S9X909

Protein Details
Accession S9X909    Localization Confidence Medium Confidence Score 14.3
NoLS Segment(s)
PositionSequenceProtein Nature
21-45RWNIENEKRIRKERKKHIMSCKQEVHydrophilic
NLS Segment(s)
PositionSequence
28-36KRIRKERKK
Subcellular Location(s) nucl 23, cyto_nucl 13.5
Family & Domain DBs
Amino Acid Sequences MEFKGSINEQIIEKVLCSLSRWNIENEKRIRKERKKHIMSCKQEVLNMVDEASKRIKKMQYKERKEIAIHNKDMEK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.14
2 0.13
3 0.12
4 0.13
5 0.16
6 0.19
7 0.23
8 0.24
9 0.26
10 0.34
11 0.38
12 0.45
13 0.48
14 0.53
15 0.54
16 0.61
17 0.68
18 0.69
19 0.75
20 0.78
21 0.82
22 0.81
23 0.84
24 0.86
25 0.86
26 0.82
27 0.78
28 0.72
29 0.62
30 0.54
31 0.47
32 0.38
33 0.3
34 0.24
35 0.19
36 0.15
37 0.14
38 0.16
39 0.2
40 0.19
41 0.17
42 0.23
43 0.3
44 0.36
45 0.46
46 0.55
47 0.6
48 0.68
49 0.76
50 0.77
51 0.75
52 0.7
53 0.7
54 0.7
55 0.68
56 0.62