Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

S9WX43

Protein Details
Accession S9WX43    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
103-131LYPLSKQRLDDKRKSLREKTKKLNTVGFSHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto_nucl 14.833, nucl 13, cyto 8.5, cyto_pero 5.664, plas 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR034104  Lsm1  
IPR010920  LSM_dom_sf  
IPR044642  PTHR15588  
IPR047575  Sm  
IPR001163  Sm_dom_euk/arc  
Gene Ontology GO:1990726  C:Lsm1-7-Pat1 complex  
GO:0005634  C:nucleus  
GO:0000932  C:P-body  
GO:1990904  C:ribonucleoprotein complex  
GO:0003682  F:chromatin binding  
GO:0003729  F:mRNA binding  
GO:0000339  F:RNA cap binding  
GO:0000290  P:deadenylation-dependent decapping of nuclear-transcribed mRNA  
GO:0006397  P:mRNA processing  
Pfam View protein in Pfam  
PF01423  LSM  
PROSITE View protein in PROSITE  
PS52002  SM  
CDD cd01728  LSm1  
Amino Acid Sequences MNQAGQIIPFTTSGSLVDYVDRKVIVVLRDGKKLIGILRSFDQFANLMLQYTIERIYVDDMYGDIDRGVYIIRGENVVLLGELDLDKEYEMERGLRRVPAEHLYPLSKQRLDDKRKSLREKTKKLNTVGFSVDFGHDDLY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.11
2 0.12
3 0.11
4 0.14
5 0.14
6 0.15
7 0.16
8 0.15
9 0.13
10 0.14
11 0.16
12 0.14
13 0.19
14 0.27
15 0.28
16 0.32
17 0.32
18 0.31
19 0.29
20 0.29
21 0.25
22 0.22
23 0.2
24 0.19
25 0.21
26 0.22
27 0.23
28 0.21
29 0.2
30 0.14
31 0.14
32 0.14
33 0.11
34 0.1
35 0.09
36 0.09
37 0.08
38 0.09
39 0.08
40 0.06
41 0.06
42 0.06
43 0.08
44 0.08
45 0.07
46 0.07
47 0.06
48 0.08
49 0.07
50 0.07
51 0.05
52 0.05
53 0.05
54 0.05
55 0.05
56 0.03
57 0.04
58 0.04
59 0.04
60 0.05
61 0.05
62 0.05
63 0.05
64 0.05
65 0.04
66 0.04
67 0.03
68 0.03
69 0.03
70 0.04
71 0.04
72 0.04
73 0.04
74 0.04
75 0.05
76 0.05
77 0.06
78 0.08
79 0.09
80 0.12
81 0.13
82 0.15
83 0.16
84 0.17
85 0.2
86 0.21
87 0.22
88 0.23
89 0.24
90 0.24
91 0.26
92 0.3
93 0.32
94 0.29
95 0.28
96 0.36
97 0.43
98 0.5
99 0.56
100 0.6
101 0.65
102 0.73
103 0.81
104 0.81
105 0.82
106 0.85
107 0.86
108 0.87
109 0.87
110 0.85
111 0.83
112 0.8
113 0.72
114 0.65
115 0.59
116 0.5
117 0.4
118 0.35
119 0.3
120 0.23