Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

S9XEF3

Protein Details
Accession S9XEF3    Localization Confidence Medium Confidence Score 11
NoLS Segment(s)
PositionSequenceProtein Nature
30-49KKPENARSSKPKKNVNKEDDBasic
NLS Segment(s)
PositionSequence
36-41RSSKPK
Subcellular Location(s) cyto_nucl 12.833, nucl 12.5, cyto 10, cyto_pero 5.999
Family & Domain DBs
InterPro View protein in InterPro  
IPR013885  DUF1764_euk  
Pfam View protein in Pfam  
PF08576  DUF1764  
Amino Acid Sequences MEIDDIFSQKKAQPKEQGPVEKEQNQQEPKKPENARSSKPKKNVNKEDDLFLDPKGASGRKRTEEGFLVYDEDELKMGKGGTTPLCPFDCECCKEILKVSCVLHYTNFL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.48
2 0.56
3 0.63
4 0.68
5 0.64
6 0.66
7 0.65
8 0.62
9 0.61
10 0.58
11 0.58
12 0.57
13 0.59
14 0.59
15 0.59
16 0.56
17 0.6
18 0.57
19 0.57
20 0.6
21 0.62
22 0.61
23 0.65
24 0.71
25 0.69
26 0.74
27 0.75
28 0.74
29 0.78
30 0.81
31 0.77
32 0.77
33 0.7
34 0.65
35 0.57
36 0.5
37 0.4
38 0.29
39 0.24
40 0.15
41 0.14
42 0.13
43 0.13
44 0.12
45 0.17
46 0.22
47 0.23
48 0.25
49 0.26
50 0.27
51 0.27
52 0.29
53 0.24
54 0.2
55 0.19
56 0.16
57 0.16
58 0.13
59 0.11
60 0.08
61 0.07
62 0.07
63 0.06
64 0.06
65 0.06
66 0.06
67 0.09
68 0.11
69 0.15
70 0.16
71 0.19
72 0.2
73 0.21
74 0.22
75 0.26
76 0.31
77 0.3
78 0.31
79 0.31
80 0.32
81 0.32
82 0.38
83 0.37
84 0.33
85 0.35
86 0.35
87 0.35
88 0.35
89 0.35