Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

S9XAM5

Protein Details
Accession S9XAM5   
Localization Confidence Medium
Confidence Score 12.5
NoLS Segment(s)
PositionSequenceProtein Nature
73-94EVIRLLKKSIKKKKQAIEQFLSHydrophilic
NLS Segment(s)
PositionSequence
81-85SIKKK
Subcellular Location(s) nucl 15.5, mito 10, cyto_nucl 9
Family & Domain DBs
InterPro View protein in InterPro  
IPR003789  Asn/Gln_tRNA_amidoTrase-B-like  
IPR019004  YqeY/Aim41  
IPR042184  YqeY/Aim41_N  
Gene Ontology GO:0005739  C:mitochondrion  
GO:0016884  F:carbon-nitrogen ligase activity, with glutamine as amido-N-donor  
Pfam View protein in Pfam  
PF09424  YqeY  
Amino Acid Sequences MQSLLRTRLYSISFKYRSFATNNVMPALQSEIRKKLMESMRNKDKKQSSTIKLFLSEIEIANKSNRPVTNDSEVIRLLKKSIKKKKQAIEQFLSANRTDLSDKEKVEIEILQKFLPRDS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.4
2 0.4
3 0.37
4 0.37
5 0.35
6 0.35
7 0.3
8 0.31
9 0.32
10 0.31
11 0.29
12 0.25
13 0.23
14 0.23
15 0.21
16 0.2
17 0.22
18 0.25
19 0.28
20 0.29
21 0.28
22 0.31
23 0.35
24 0.4
25 0.44
26 0.49
27 0.57
28 0.63
29 0.64
30 0.63
31 0.63
32 0.58
33 0.59
34 0.59
35 0.54
36 0.54
37 0.57
38 0.5
39 0.44
40 0.4
41 0.32
42 0.25
43 0.21
44 0.14
45 0.12
46 0.11
47 0.11
48 0.12
49 0.13
50 0.11
51 0.14
52 0.15
53 0.18
54 0.21
55 0.25
56 0.28
57 0.3
58 0.3
59 0.28
60 0.27
61 0.24
62 0.21
63 0.17
64 0.14
65 0.17
66 0.23
67 0.32
68 0.42
69 0.51
70 0.59
71 0.68
72 0.75
73 0.81
74 0.83
75 0.82
76 0.76
77 0.7
78 0.65
79 0.59
80 0.53
81 0.43
82 0.34
83 0.26
84 0.22
85 0.2
86 0.17
87 0.2
88 0.23
89 0.23
90 0.24
91 0.26
92 0.25
93 0.25
94 0.27
95 0.25
96 0.24
97 0.25
98 0.25
99 0.25