Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

S9X994

Protein Details
Accession S9X994   
Localization Confidence Medium
Confidence Score 13
NoLS Segment(s)
PositionSequenceProtein Nature
96-124CGSTKRFPFSKAKRNKQKKDDRVNESEMMHydrophilic
NLS Segment(s)
PositionSequence
107-112AKRNKQ
Subcellular Location(s) nucl 17.5, cyto_nucl 10.5, mito 7
Family & Domain DBs
InterPro View protein in InterPro  
IPR007175  Rpr2/Snm1/Rpp21  
Gene Ontology GO:1902555  C:endoribonuclease complex  
GO:1990904  C:ribonucleoprotein complex  
GO:0034470  P:ncRNA processing  
Pfam View protein in Pfam  
PF04032  Rpr2  
Amino Acid Sequences MSSKQQDQHCRISYLYQAAHYLLQHTEQAKFSRHYISTAKQVSQKSVLRLHPNIKRTICKKCNSLMVFGKSCSVRTEEPSKRKPECDRSLWVCNECGSTKRFPFSKAKRNKQKKDDRVNESEMMAP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.42
2 0.38
3 0.29
4 0.26
5 0.25
6 0.26
7 0.23
8 0.2
9 0.15
10 0.15
11 0.17
12 0.17
13 0.18
14 0.19
15 0.22
16 0.24
17 0.25
18 0.26
19 0.28
20 0.28
21 0.29
22 0.3
23 0.31
24 0.36
25 0.37
26 0.37
27 0.37
28 0.37
29 0.36
30 0.38
31 0.38
32 0.33
33 0.37
34 0.38
35 0.39
36 0.42
37 0.46
38 0.45
39 0.46
40 0.48
41 0.44
42 0.47
43 0.45
44 0.52
45 0.52
46 0.5
47 0.5
48 0.47
49 0.52
50 0.46
51 0.47
52 0.41
53 0.39
54 0.36
55 0.33
56 0.33
57 0.25
58 0.24
59 0.2
60 0.18
61 0.15
62 0.18
63 0.27
64 0.33
65 0.42
66 0.48
67 0.54
68 0.54
69 0.59
70 0.63
71 0.64
72 0.63
73 0.6
74 0.61
75 0.6
76 0.64
77 0.62
78 0.55
79 0.45
80 0.39
81 0.36
82 0.3
83 0.26
84 0.22
85 0.25
86 0.26
87 0.31
88 0.32
89 0.34
90 0.44
91 0.51
92 0.58
93 0.63
94 0.71
95 0.77
96 0.86
97 0.92
98 0.92
99 0.93
100 0.94
101 0.94
102 0.93
103 0.9
104 0.87
105 0.82
106 0.73