Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

S9W8B3

Protein Details
Accession S9W8B3    Localization Confidence Medium Confidence Score 13.3
NoLS Segment(s)
PositionSequenceProtein Nature
1-31MAKSKNHTNHNQNKKAHRNGIKRPQKHRYDSHydrophilic
NLS Segment(s)
PositionSequence
14-41KKAHRNGIKRPQKHRYDSLKFRDAKFRR
Subcellular Location(s) nucl 17, mito 5, cyto 5, cyto_mito 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR002673  Ribosomal_L29e  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01779  Ribosomal_L29e  
Amino Acid Sequences MAKSKNHTNHNQNKKAHRNGIKRPQKHRYDSLKFRDAKFRRNQKFANRGTVEANKQAKAAASAGNA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.84
2 0.83
3 0.82
4 0.81
5 0.79
6 0.81
7 0.84
8 0.84
9 0.82
10 0.83
11 0.83
12 0.81
13 0.78
14 0.77
15 0.76
16 0.75
17 0.76
18 0.74
19 0.72
20 0.66
21 0.61
22 0.63
23 0.55
24 0.55
25 0.56
26 0.6
27 0.59
28 0.64
29 0.68
30 0.67
31 0.75
32 0.7
33 0.7
34 0.62
35 0.56
36 0.54
37 0.55
38 0.48
39 0.47
40 0.47
41 0.37
42 0.35
43 0.34
44 0.3
45 0.25
46 0.24