FuNGI

S9W5W3

Protein Details

Accession

S9W5W3

Localization Confidence

Low

Confidence Score

NoLS Segment(s)

Position	Sequence	Protein Nature
190-223	VKRQARKRTKTGCLTCRKRRIKCDERKPRQCEGY	Basic

NLS Segment(s)

Subcellular Location(s)

nucl 13.5, cyto_nucl 9, plas 8, cyto 3.5

Family & Domain DBs

InterPro	View protein in InterPro IPR036864 Zn2-C6_fun-type_DNA-bd_sf IPR001138 Zn2Cys6_DnaBD
Gene Ontology	GO:0000785 C:chromatin GO:0005634 C:nucleus GO:0000981 F:DNA-binding transcription factor activity, RNA polymerase II-specific GO:0008270 F:zinc ion binding GO:0036349 P:galactose-specific flocculation GO:0051321 P:meiotic cell cycle GO:0060257 P:negative regulation of flocculation GO:0000122 P:negative regulation of transcription by RNA polymerase II
CDD	cd00067 GAL4

Amino Acid Sequences

MNRSSNSPHQLPFAEHMQSASSQHPAAAYAYPTYQQGAPPMFHAPQHPSVLTQLPPLSATVLAPSLASLPPISSAPTYQHVASHASSPYLQHPMHSSSNAAAYSNNPFPAPNNAPPSAHDPSGYAVPSPIPPSNPVSLASPSPNDTLPASPSLSRNPTVNGSIPNPSNPSNGNGKANTSSPTGVSNASLVKRQARKRTKTGCLTCRKRRIKCDERKPRQCEGYTHFPRPTGTLTAARRIPVSSLLSEPAPHGMAGQPTHPTFLYYIQSVAPSLCLWDSCYFPPLSPYSSFSSIYWSSTIPELALRNPNISVALYAFASAKRHLTDDAIAFARQARVTLTNITTTESLLILVLLAVTQLYIPKCDIQLFNFAVDQVVKFDASLMTSPSDEIITYLLRRMFIRQVVLAGIVKPLHPEMNCLTLLKAELPLATTPTAVLDESLFNLGLRSLCHEPGLDSEFANWYNNFPVDKNDLPRLALLMIHAVFVSPASLAQWVELILLHPDPTPAIHIARACLLAVRTVINLSELQVKVDKCVKSCEEKQLQASISNFSQDVIQSNSSTLTIGV

FASTA Sequence
with NoLS information

AlphaFold Structure
with highlighted NoLS

NoLS Predictions per Residue

Residue Number	Score
1	0.34
2	0.3
3	0.28
4	0.26
5	0.25
6	0.24
7	0.22
8	0.2
9	0.18
10	0.18
11	0.17
12	0.17
13	0.17
14	0.17
15	0.16
16	0.15
17	0.16
18	0.17
19	0.17
20	0.19
21	0.18
22	0.17
23	0.22
24	0.23
25	0.22
26	0.23
27	0.27
28	0.26
29	0.27
30	0.29
31	0.3
32	0.32
33	0.36
34	0.34
35	0.3
36	0.32
37	0.34
38	0.31
39	0.29
40	0.25
41	0.21
42	0.21
43	0.2
44	0.18
45	0.15
46	0.14
47	0.11
48	0.11
49	0.1
50	0.09
51	0.09
52	0.1
53	0.09
54	0.1
55	0.08
56	0.08
57	0.09
58	0.1
59	0.12
60	0.11
61	0.12
62	0.15
63	0.19
64	0.21
65	0.2
66	0.21
67	0.21
68	0.23
69	0.23
70	0.23
71	0.2
72	0.19
73	0.2
74	0.2
75	0.22
76	0.25
77	0.24
78	0.21
79	0.25
80	0.29
81	0.31
82	0.3
83	0.28
84	0.22
85	0.26
86	0.25
87	0.21
88	0.16
89	0.15
90	0.2
91	0.21
92	0.21
93	0.17
94	0.17
95	0.19
96	0.27
97	0.31
98	0.32
99	0.35
100	0.36
101	0.37
102	0.39
103	0.44
104	0.39
105	0.34
106	0.27
107	0.22
108	0.22
109	0.25
110	0.23
111	0.16
112	0.12
113	0.13
114	0.15
115	0.18
116	0.17
117	0.15
118	0.18
119	0.22
120	0.23
121	0.23
122	0.22
123	0.21
124	0.22
125	0.22
126	0.22
127	0.2
128	0.2
129	0.2
130	0.19
131	0.18
132	0.17
133	0.16
134	0.16
135	0.17
136	0.16
137	0.17
138	0.19
139	0.22
140	0.25
141	0.25
142	0.24
143	0.24
144	0.25
145	0.26
146	0.26
147	0.24
148	0.23
149	0.26
150	0.26
151	0.26
152	0.26
153	0.25
154	0.25
155	0.22
156	0.24
157	0.26
158	0.28
159	0.3
160	0.27
161	0.28
162	0.28
163	0.28
164	0.27
165	0.22
166	0.19
167	0.16
168	0.17
169	0.16
170	0.14
171	0.13
172	0.12
173	0.13
174	0.14
175	0.16
176	0.16
177	0.22
178	0.3
179	0.36
180	0.46
181	0.53
182	0.59
183	0.66
184	0.74
185	0.75
186	0.78
187	0.8
188	0.79
189	0.79
190	0.82
191	0.82
192	0.84
193	0.84
194	0.81
195	0.82
196	0.83
197	0.83
198	0.84
199	0.86
200	0.87
201	0.88
202	0.91
203	0.88
204	0.84
205	0.8
206	0.72
207	0.66
208	0.61
209	0.62
210	0.57
211	0.55
212	0.49
213	0.43
214	0.41
215	0.37
216	0.33
217	0.24
218	0.21
219	0.23
220	0.24
221	0.28
222	0.29
223	0.27
224	0.25
225	0.23
226	0.21
227	0.17
228	0.18
229	0.14
230	0.13
231	0.14
232	0.13
233	0.14
234	0.13
235	0.11
236	0.09
237	0.08
238	0.07
239	0.07
240	0.09
241	0.09
242	0.1
243	0.11
244	0.11
245	0.13
246	0.12
247	0.12
248	0.1
249	0.13
250	0.13
251	0.11
252	0.11
253	0.11
254	0.11
255	0.1
256	0.09
257	0.07
258	0.06
259	0.06
260	0.05
261	0.05
262	0.07
263	0.08
264	0.1
265	0.09
266	0.12
267	0.11
268	0.11
269	0.14
270	0.13
271	0.14
272	0.13
273	0.16
274	0.17
275	0.19
276	0.2
277	0.18
278	0.22
279	0.2
280	0.19
281	0.17
282	0.14
283	0.13
284	0.12
285	0.12
286	0.07
287	0.09
288	0.09
289	0.1
290	0.15
291	0.14
292	0.15
293	0.15
294	0.15
295	0.13
296	0.12
297	0.1
298	0.06
299	0.07
300	0.06
301	0.06
302	0.06
303	0.07
304	0.08
305	0.08
306	0.1
307	0.1
308	0.11
309	0.11
310	0.12
311	0.13
312	0.12
313	0.14
314	0.14
315	0.13
316	0.12
317	0.13
318	0.13
319	0.1
320	0.1
321	0.09
322	0.1
323	0.11
324	0.14
325	0.14
326	0.15
327	0.15
328	0.16
329	0.15
330	0.13
331	0.12
332	0.09
333	0.09
334	0.06
335	0.06
336	0.04
337	0.04
338	0.03
339	0.02
340	0.02
341	0.02
342	0.02
343	0.02
344	0.05
345	0.05
346	0.06
347	0.07
348	0.09
349	0.1
350	0.13
351	0.14
352	0.13
353	0.2
354	0.2
355	0.2
356	0.19
357	0.18
358	0.16
359	0.15
360	0.13
361	0.08
362	0.08
363	0.07
364	0.07
365	0.07
366	0.07
367	0.08
368	0.08
369	0.08
370	0.08
371	0.08
372	0.09
373	0.08
374	0.08
375	0.07
376	0.07
377	0.07
378	0.07
379	0.08
380	0.11
381	0.11
382	0.12
383	0.13
384	0.16
385	0.19
386	0.2
387	0.21
388	0.19
389	0.19
390	0.18
391	0.19
392	0.17
393	0.13
394	0.12
395	0.11
396	0.1
397	0.11
398	0.11
399	0.13
400	0.13
401	0.16
402	0.16
403	0.19
404	0.2
405	0.19
406	0.18
407	0.16
408	0.16
409	0.14
410	0.13
411	0.09
412	0.09
413	0.1
414	0.1
415	0.12
416	0.11
417	0.1
418	0.09
419	0.09
420	0.1
421	0.08
422	0.08
423	0.07
424	0.07
425	0.08
426	0.1
427	0.09
428	0.08
429	0.08
430	0.09
431	0.08
432	0.08
433	0.12
434	0.14
435	0.14
436	0.15
437	0.16
438	0.16
439	0.19
440	0.22
441	0.18
442	0.15
443	0.16
444	0.17
445	0.18
446	0.2
447	0.16
448	0.14
449	0.16
450	0.18
451	0.18
452	0.17
453	0.2
454	0.24
455	0.28
456	0.32
457	0.35
458	0.34
459	0.34
460	0.33
461	0.3
462	0.24
463	0.2
464	0.16
465	0.14
466	0.13
467	0.12
468	0.12
469	0.1
470	0.09
471	0.09
472	0.09
473	0.04
474	0.04
475	0.05
476	0.07
477	0.07
478	0.07
479	0.08
480	0.07
481	0.08
482	0.08
483	0.08
484	0.08
485	0.09
486	0.1
487	0.09
488	0.1
489	0.1
490	0.1
491	0.12
492	0.13
493	0.14
494	0.16
495	0.17
496	0.18
497	0.2
498	0.2
499	0.17
500	0.17
501	0.16
502	0.15
503	0.15
504	0.14
505	0.13
506	0.13
507	0.13
508	0.12
509	0.12
510	0.12
511	0.19
512	0.18
513	0.2
514	0.24
515	0.24
516	0.27
517	0.34
518	0.35
519	0.29
520	0.37
521	0.4
522	0.44
523	0.5
524	0.56
525	0.57
526	0.6
527	0.62
528	0.61
529	0.58
530	0.54
531	0.49
532	0.43
533	0.36
534	0.32
535	0.28
536	0.22
537	0.22
538	0.18
539	0.2
540	0.2
541	0.21
542	0.19
543	0.2
544	0.21
545	0.19

S9W5W3

3D AlphaFold-predicted Structure Viewer