Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

S9X9N1

Protein Details
Accession S9X9N1    Localization Confidence Medium Confidence Score 11.1
NoLS Segment(s)
PositionSequenceProtein Nature
341-367SLTPSKIPLPTRKKRKFETDNTTKFEEHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 24, cyto_nucl 15.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR018479  Lrs4/Mde4  
Gene Ontology GO:0034506  C:chromosome, centromeric core domain  
GO:0033551  C:monopolin complex  
GO:0005730  C:nucleolus  
GO:0051315  P:attachment of mitotic spindle microtubules to kinetochore  
GO:0045144  P:meiotic sister chromatid segregation  
GO:1990893  P:mitotic chromosome centromere condensation  
Pfam View protein in Pfam  
PF10422  LRS4  
Amino Acid Sequences MNVEDLSKKHTNSLHQAENRLLQCQLELNFYLTKASNVIHGLQSHILRTTCLEATNHANKLLLQLNEGGQKSEENDRRASKLEEVNGSLTSDIVQLKSKISSLEANISQNLEDMSKLHKLNLENSGQEELPLMNADSEHAESKASYMSPDKTNLSSSNAEQVARLHRTITELKKSYKEKDSDLNKLHSALSAKESELNRWKIKLETEESNWKVRLQVLESKVATQGKKLRKNEVKRSKSTLITPGLTSSNTKSPLSPALRSPPKKSPLRVTPYLQRTSAIVGLPSSPSQASPTIRSGITTTTQTPNKDSSLIGSARKETDHNNIDSGNAEENPASSRRLSSLTPSKIPLPTRKKRKFETDNTTKFEELDESDTSMTMEVPLQTKVTLPRTISPPKARSESLVALKDKFKMKKGV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.57
2 0.57
3 0.6
4 0.58
5 0.61
6 0.55
7 0.47
8 0.4
9 0.3
10 0.26
11 0.27
12 0.25
13 0.21
14 0.21
15 0.21
16 0.22
17 0.22
18 0.24
19 0.2
20 0.19
21 0.17
22 0.16
23 0.17
24 0.17
25 0.2
26 0.2
27 0.2
28 0.22
29 0.24
30 0.25
31 0.23
32 0.25
33 0.22
34 0.2
35 0.21
36 0.22
37 0.19
38 0.21
39 0.2
40 0.19
41 0.28
42 0.34
43 0.34
44 0.3
45 0.29
46 0.27
47 0.31
48 0.33
49 0.25
50 0.2
51 0.2
52 0.22
53 0.28
54 0.28
55 0.24
56 0.19
57 0.19
58 0.2
59 0.29
60 0.32
61 0.29
62 0.35
63 0.37
64 0.4
65 0.42
66 0.42
67 0.39
68 0.38
69 0.39
70 0.37
71 0.36
72 0.35
73 0.32
74 0.29
75 0.23
76 0.17
77 0.13
78 0.12
79 0.11
80 0.1
81 0.12
82 0.13
83 0.14
84 0.15
85 0.16
86 0.14
87 0.15
88 0.17
89 0.17
90 0.22
91 0.23
92 0.24
93 0.24
94 0.24
95 0.22
96 0.19
97 0.17
98 0.11
99 0.09
100 0.08
101 0.11
102 0.15
103 0.16
104 0.17
105 0.2
106 0.21
107 0.26
108 0.31
109 0.3
110 0.25
111 0.27
112 0.28
113 0.24
114 0.22
115 0.18
116 0.12
117 0.1
118 0.1
119 0.08
120 0.06
121 0.06
122 0.06
123 0.07
124 0.08
125 0.08
126 0.08
127 0.08
128 0.08
129 0.09
130 0.1
131 0.08
132 0.09
133 0.11
134 0.14
135 0.16
136 0.19
137 0.2
138 0.2
139 0.22
140 0.22
141 0.24
142 0.22
143 0.21
144 0.24
145 0.23
146 0.22
147 0.2
148 0.21
149 0.22
150 0.23
151 0.22
152 0.17
153 0.16
154 0.2
155 0.26
156 0.29
157 0.31
158 0.33
159 0.35
160 0.42
161 0.46
162 0.47
163 0.48
164 0.45
165 0.4
166 0.45
167 0.48
168 0.49
169 0.49
170 0.46
171 0.39
172 0.38
173 0.35
174 0.28
175 0.24
176 0.17
177 0.16
178 0.13
179 0.13
180 0.17
181 0.17
182 0.2
183 0.26
184 0.31
185 0.29
186 0.29
187 0.3
188 0.26
189 0.28
190 0.28
191 0.24
192 0.22
193 0.25
194 0.32
195 0.33
196 0.35
197 0.33
198 0.29
199 0.26
200 0.24
201 0.22
202 0.17
203 0.21
204 0.2
205 0.25
206 0.25
207 0.25
208 0.26
209 0.28
210 0.25
211 0.22
212 0.28
213 0.32
214 0.41
215 0.43
216 0.5
217 0.56
218 0.65
219 0.72
220 0.76
221 0.74
222 0.7
223 0.75
224 0.69
225 0.63
226 0.57
227 0.52
228 0.45
229 0.38
230 0.34
231 0.28
232 0.25
233 0.23
234 0.21
235 0.16
236 0.17
237 0.19
238 0.19
239 0.18
240 0.19
241 0.26
242 0.28
243 0.28
244 0.26
245 0.33
246 0.42
247 0.45
248 0.49
249 0.49
250 0.54
251 0.58
252 0.59
253 0.59
254 0.59
255 0.64
256 0.63
257 0.59
258 0.6
259 0.61
260 0.6
261 0.51
262 0.42
263 0.35
264 0.32
265 0.3
266 0.21
267 0.14
268 0.11
269 0.12
270 0.13
271 0.12
272 0.11
273 0.09
274 0.09
275 0.11
276 0.15
277 0.16
278 0.18
279 0.2
280 0.22
281 0.22
282 0.22
283 0.21
284 0.19
285 0.19
286 0.18
287 0.19
288 0.24
289 0.28
290 0.28
291 0.3
292 0.31
293 0.3
294 0.29
295 0.25
296 0.21
297 0.23
298 0.24
299 0.25
300 0.24
301 0.25
302 0.25
303 0.26
304 0.25
305 0.23
306 0.3
307 0.32
308 0.31
309 0.3
310 0.29
311 0.29
312 0.28
313 0.26
314 0.19
315 0.14
316 0.13
317 0.11
318 0.12
319 0.14
320 0.14
321 0.14
322 0.13
323 0.14
324 0.15
325 0.18
326 0.19
327 0.25
328 0.33
329 0.37
330 0.39
331 0.4
332 0.42
333 0.45
334 0.5
335 0.52
336 0.53
337 0.57
338 0.66
339 0.74
340 0.78
341 0.8
342 0.86
343 0.85
344 0.85
345 0.86
346 0.86
347 0.84
348 0.81
349 0.77
350 0.66
351 0.56
352 0.47
353 0.38
354 0.29
355 0.25
356 0.21
357 0.19
358 0.19
359 0.19
360 0.18
361 0.15
362 0.12
363 0.09
364 0.1
365 0.1
366 0.12
367 0.13
368 0.13
369 0.13
370 0.16
371 0.22
372 0.26
373 0.29
374 0.3
375 0.35
376 0.42
377 0.5
378 0.56
379 0.59
380 0.59
381 0.61
382 0.64
383 0.59
384 0.56
385 0.55
386 0.54
387 0.52
388 0.54
389 0.5
390 0.48
391 0.5
392 0.51
393 0.53
394 0.5