Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

S9WX89

Protein Details
Accession S9WX89   
Localization Confidence Low
Confidence Score 9.2
NoLS Segment(s)
PositionSequenceProtein Nature
1-21MAPKKKWSKGKVKDKAQHATVHydrophilic
NLS Segment(s)
PositionSequence
4-12KKKWSKGKV
Subcellular Location(s) cyto 15.5, cyto_nucl 10.5, mito 7, nucl 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR004977  Ribosomal_S25  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
Pfam View protein in Pfam  
PF03297  Ribosomal_S25  
Amino Acid Sequences MAPKKKWSKGKVKDKAQHATVFDKTLIDRINKEVPAFKFVSVSVLVDRMKINGALARIAIKDLAERGVINKVDHSSKQYIYTRIPATA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.86
2 0.84
3 0.77
4 0.71
5 0.63
6 0.58
7 0.49
8 0.43
9 0.35
10 0.28
11 0.23
12 0.22
13 0.22
14 0.18
15 0.18
16 0.2
17 0.25
18 0.25
19 0.25
20 0.27
21 0.25
22 0.28
23 0.28
24 0.24
25 0.19
26 0.18
27 0.2
28 0.14
29 0.13
30 0.09
31 0.1
32 0.1
33 0.1
34 0.1
35 0.09
36 0.09
37 0.09
38 0.09
39 0.08
40 0.08
41 0.08
42 0.08
43 0.09
44 0.08
45 0.09
46 0.09
47 0.07
48 0.07
49 0.08
50 0.09
51 0.08
52 0.08
53 0.09
54 0.15
55 0.16
56 0.16
57 0.18
58 0.19
59 0.23
60 0.25
61 0.29
62 0.28
63 0.28
64 0.36
65 0.38
66 0.4
67 0.4
68 0.46