Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

S9VTX2

Protein Details
Accession S9VTX2    Localization Confidence High Confidence Score 16.3
NoLS Segment(s)
PositionSequenceProtein Nature
145-168GEKEKKMTSKQVRNNSRNIKRSRRHydrophilic
NLS Segment(s)
PositionSequence
83-113RAKHLPKPKPETKWQRFARIKGIAPKKREGK
160-168SRNIKRSRR
Subcellular Location(s) nucl 23, cyto_nucl 13.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR007023  Ribosom_reg  
Gene Ontology GO:0005730  C:nucleolus  
GO:0042273  P:ribosomal large subunit biogenesis  
Pfam View protein in Pfam  
PF04939  RRS1  
Amino Acid Sequences MSTSVEKAIPLEYDLGNMSAFDVTPLDETKLSSQKSQEKEEYLSSMARDNTQLLVNKMLALPKERTQDGILLALPESTTPLPRAKHLPKPKPETKWQRFARIKGIAPKKREGKLVFDEASGEWVPKWGYKGKNKELDTQWIVEDGEKEKKMTSKQVRNNSRNIKRSRR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.14
2 0.14
3 0.12
4 0.11
5 0.11
6 0.08
7 0.08
8 0.07
9 0.07
10 0.07
11 0.08
12 0.1
13 0.11
14 0.11
15 0.12
16 0.17
17 0.24
18 0.25
19 0.26
20 0.31
21 0.37
22 0.42
23 0.47
24 0.45
25 0.42
26 0.43
27 0.42
28 0.38
29 0.32
30 0.28
31 0.22
32 0.22
33 0.19
34 0.17
35 0.16
36 0.15
37 0.15
38 0.17
39 0.19
40 0.16
41 0.17
42 0.16
43 0.16
44 0.16
45 0.16
46 0.14
47 0.15
48 0.17
49 0.19
50 0.23
51 0.22
52 0.23
53 0.22
54 0.23
55 0.2
56 0.19
57 0.14
58 0.11
59 0.1
60 0.08
61 0.07
62 0.06
63 0.06
64 0.05
65 0.06
66 0.08
67 0.11
68 0.12
69 0.14
70 0.22
71 0.25
72 0.34
73 0.44
74 0.51
75 0.56
76 0.64
77 0.69
78 0.67
79 0.72
80 0.74
81 0.71
82 0.73
83 0.68
84 0.7
85 0.68
86 0.65
87 0.63
88 0.57
89 0.54
90 0.53
91 0.6
92 0.55
93 0.54
94 0.59
95 0.57
96 0.55
97 0.59
98 0.51
99 0.48
100 0.47
101 0.49
102 0.42
103 0.36
104 0.34
105 0.27
106 0.28
107 0.22
108 0.16
109 0.1
110 0.11
111 0.11
112 0.11
113 0.14
114 0.18
115 0.26
116 0.35
117 0.45
118 0.52
119 0.61
120 0.62
121 0.68
122 0.65
123 0.66
124 0.59
125 0.51
126 0.43
127 0.35
128 0.33
129 0.25
130 0.24
131 0.19
132 0.24
133 0.23
134 0.24
135 0.24
136 0.29
137 0.33
138 0.41
139 0.48
140 0.51
141 0.6
142 0.7
143 0.78
144 0.79
145 0.85
146 0.85
147 0.84
148 0.83