Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

S9W8M6

Protein Details
Accession S9W8M6    Localization Confidence Medium Confidence Score 14.4
NoLS Segment(s)
PositionSequenceProtein Nature
1-24MKKSSKVSKKSSPKRTVRDAFPKIHydrophilic
NLS Segment(s)
PositionSequence
6-17KVSKKSSPKRTV
Subcellular Location(s) nucl 23, cyto_nucl 13
Family & Domain DBs
InterPro View protein in InterPro  
IPR007218  DNA_pol_delta_4  
Gene Ontology GO:0043625  C:delta DNA polymerase complex  
GO:0003887  F:DNA-directed DNA polymerase activity  
GO:0006271  P:DNA strand elongation involved in DNA replication  
GO:1904161  P:DNA synthesis involved in UV-damage excision repair  
Pfam View protein in Pfam  
PF04081  DNA_pol_delta_4  
Amino Acid Sequences MKKSSKVSKKSSPKRTVRDAFPKIIRGNEKNSSTDKKSKYSGSEKETKKEVAGSLSLEERIESDPELSKALDDAYKSILSERMSLPVHEQELSKVQLVLHHFDMSAKYGPYLGMTRLERWRRAKRFELNPPDIIEQVLTLEEADEENRKRETLFYDFKPMVGE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.86
2 0.88
3 0.86
4 0.84
5 0.84
6 0.79
7 0.77
8 0.71
9 0.7
10 0.61
11 0.6
12 0.58
13 0.52
14 0.52
15 0.52
16 0.51
17 0.48
18 0.51
19 0.51
20 0.5
21 0.55
22 0.52
23 0.49
24 0.5
25 0.51
26 0.52
27 0.54
28 0.55
29 0.53
30 0.59
31 0.57
32 0.58
33 0.57
34 0.5
35 0.42
36 0.37
37 0.31
38 0.23
39 0.21
40 0.18
41 0.15
42 0.15
43 0.15
44 0.12
45 0.11
46 0.1
47 0.1
48 0.09
49 0.08
50 0.09
51 0.09
52 0.1
53 0.11
54 0.1
55 0.09
56 0.08
57 0.09
58 0.08
59 0.07
60 0.07
61 0.08
62 0.09
63 0.09
64 0.09
65 0.11
66 0.11
67 0.12
68 0.12
69 0.14
70 0.14
71 0.15
72 0.16
73 0.15
74 0.15
75 0.14
76 0.14
77 0.11
78 0.14
79 0.15
80 0.13
81 0.12
82 0.11
83 0.13
84 0.15
85 0.17
86 0.15
87 0.14
88 0.14
89 0.14
90 0.15
91 0.14
92 0.14
93 0.11
94 0.1
95 0.1
96 0.1
97 0.11
98 0.12
99 0.1
100 0.15
101 0.16
102 0.2
103 0.29
104 0.34
105 0.39
106 0.47
107 0.57
108 0.58
109 0.64
110 0.69
111 0.69
112 0.74
113 0.77
114 0.79
115 0.73
116 0.68
117 0.65
118 0.58
119 0.49
120 0.39
121 0.29
122 0.18
123 0.14
124 0.11
125 0.08
126 0.06
127 0.06
128 0.06
129 0.06
130 0.08
131 0.13
132 0.15
133 0.18
134 0.19
135 0.2
136 0.2
137 0.22
138 0.26
139 0.29
140 0.35
141 0.35
142 0.43
143 0.43