Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

S9W2K5

Protein Details
Accession S9W2K5   
Localization Confidence Low
Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
108-130FERFAVVRYKKQRRNQVQLAVASHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 13cyto 13cyto_mito 13
Family & Domain DBs
InterPro View protein in InterPro  
IPR005824  KOW  
IPR014722  Rib_L2_dom2  
IPR002784  Ribosomal_L14e_dom  
IPR039660  Ribosomal_protein_L14  
IPR041985  RPL14_KOW  
IPR008991  Translation_prot_SH3-like_sf  
Gene Ontology GO:0005840  C:ribosome  
GO:0003723  F:RNA binding  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00467  KOW  
PF01929  Ribosomal_L14e  
CDD cd06088  KOW_RPL14  
Amino Acid Sequences MNGFQRYVQVGRIILLKAGPQKGKLAAIVDIIDHKRVIVDSICQEFPRQIVRLSQVTLTSIVMSIPRGATSGIVAKKWQAQNISQKWAATAWAKKLEALKTRSQLGDFERFAVVRYKKQRRNQVQLAVASA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.17
2 0.16
3 0.18
4 0.21
5 0.26
6 0.27
7 0.25
8 0.28
9 0.29
10 0.3
11 0.28
12 0.24
13 0.19
14 0.18
15 0.17
16 0.14
17 0.17
18 0.16
19 0.16
20 0.14
21 0.12
22 0.12
23 0.11
24 0.13
25 0.09
26 0.11
27 0.14
28 0.18
29 0.19
30 0.18
31 0.19
32 0.17
33 0.18
34 0.19
35 0.16
36 0.14
37 0.15
38 0.19
39 0.2
40 0.2
41 0.2
42 0.16
43 0.16
44 0.15
45 0.13
46 0.09
47 0.07
48 0.07
49 0.06
50 0.06
51 0.05
52 0.05
53 0.05
54 0.05
55 0.05
56 0.05
57 0.05
58 0.1
59 0.11
60 0.11
61 0.11
62 0.12
63 0.18
64 0.2
65 0.22
66 0.19
67 0.24
68 0.33
69 0.37
70 0.42
71 0.37
72 0.35
73 0.33
74 0.31
75 0.28
76 0.23
77 0.22
78 0.22
79 0.26
80 0.26
81 0.28
82 0.32
83 0.36
84 0.38
85 0.4
86 0.42
87 0.39
88 0.43
89 0.42
90 0.39
91 0.36
92 0.33
93 0.37
94 0.31
95 0.29
96 0.27
97 0.26
98 0.26
99 0.32
100 0.3
101 0.31
102 0.41
103 0.5
104 0.58
105 0.68
106 0.78
107 0.79
108 0.86
109 0.86
110 0.85
111 0.81