Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

S9VYR1

Protein Details
Accession S9VYR1    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
214-236MAMLFINRSNKRRRQRKQIKKEKHydrophilic
NLS Segment(s)
PositionSequence
222-236SNKRRRQRKQIKKEK
Subcellular Location(s) E.R. 8, extr 5, mito 4.5, golg 4, cyto_mito 3.5, plas 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR036249  Thioredoxin-like_sf  
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MFFLKKLLGSCLFLGSLMQAVQSVSCHSDETVSIQALEASGVAWKELELTPSCALDSSLVSNLTDKNWDESIKSDEWLVQLTLNPCDFCLKEDYIFNDLSHHMKETYPNIQFGRVYVNDNPELAVRLLVEKLPIYYFINGANYYTVPASELPAKKALTAYSKHKFSEFERVKGFFSFVGPFMIFYKFLGKILALYSRFSSPYTPLLINISMFVMAMLFINRSNKRRRQRKQIKKEK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.19
2 0.14
3 0.12
4 0.09
5 0.08
6 0.07
7 0.07
8 0.07
9 0.08
10 0.09
11 0.1
12 0.1
13 0.11
14 0.11
15 0.12
16 0.12
17 0.16
18 0.17
19 0.16
20 0.15
21 0.14
22 0.14
23 0.13
24 0.12
25 0.08
26 0.05
27 0.06
28 0.06
29 0.06
30 0.06
31 0.05
32 0.08
33 0.09
34 0.12
35 0.12
36 0.16
37 0.17
38 0.17
39 0.17
40 0.15
41 0.15
42 0.12
43 0.12
44 0.1
45 0.11
46 0.11
47 0.11
48 0.12
49 0.13
50 0.13
51 0.15
52 0.13
53 0.15
54 0.16
55 0.17
56 0.16
57 0.18
58 0.22
59 0.2
60 0.19
61 0.16
62 0.15
63 0.15
64 0.16
65 0.14
66 0.09
67 0.11
68 0.12
69 0.14
70 0.14
71 0.13
72 0.12
73 0.14
74 0.14
75 0.13
76 0.15
77 0.14
78 0.15
79 0.16
80 0.19
81 0.19
82 0.2
83 0.18
84 0.16
85 0.16
86 0.16
87 0.15
88 0.13
89 0.11
90 0.11
91 0.14
92 0.15
93 0.21
94 0.2
95 0.23
96 0.22
97 0.22
98 0.22
99 0.2
100 0.21
101 0.15
102 0.17
103 0.16
104 0.19
105 0.18
106 0.18
107 0.18
108 0.13
109 0.13
110 0.1
111 0.09
112 0.06
113 0.06
114 0.07
115 0.06
116 0.07
117 0.05
118 0.06
119 0.06
120 0.08
121 0.08
122 0.08
123 0.09
124 0.09
125 0.11
126 0.11
127 0.11
128 0.1
129 0.09
130 0.09
131 0.08
132 0.07
133 0.06
134 0.07
135 0.08
136 0.14
137 0.15
138 0.16
139 0.2
140 0.2
141 0.2
142 0.21
143 0.21
144 0.2
145 0.23
146 0.29
147 0.33
148 0.36
149 0.36
150 0.37
151 0.37
152 0.35
153 0.42
154 0.38
155 0.36
156 0.37
157 0.38
158 0.38
159 0.36
160 0.35
161 0.24
162 0.21
163 0.18
164 0.14
165 0.15
166 0.13
167 0.14
168 0.14
169 0.15
170 0.13
171 0.12
172 0.16
173 0.14
174 0.14
175 0.14
176 0.13
177 0.12
178 0.14
179 0.2
180 0.17
181 0.18
182 0.2
183 0.21
184 0.22
185 0.22
186 0.22
187 0.18
188 0.21
189 0.23
190 0.21
191 0.2
192 0.23
193 0.23
194 0.21
195 0.19
196 0.16
197 0.12
198 0.11
199 0.1
200 0.06
201 0.05
202 0.06
203 0.06
204 0.06
205 0.08
206 0.17
207 0.23
208 0.3
209 0.4
210 0.49
211 0.6
212 0.7
213 0.78
214 0.82
215 0.87
216 0.92