Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

S9VY28

Protein Details
Accession S9VY28    Localization Confidence Medium Confidence Score 14.3
NoLS Segment(s)
PositionSequenceProtein Nature
42-62SLPPRSIAKRHPNLNHNTRKPHydrophilic
NLS Segment(s)
PositionSequence
370-376KPRKSKK
Subcellular Location(s) nucl 24, cyto_nucl 14
Family & Domain DBs
InterPro View protein in InterPro  
IPR012916  RED_N  
Pfam View protein in Pfam  
PF07808  RED_N  
Amino Acid Sequences MNQDDFRKLLATPRSENSELDRLPKRSQGPSFGRRHPRLSASLPPRSIAKRHPNLNHNTRKPSSSLSITKEASEADEPEILSENDVLVQELRGKLHRGEMTGEEFSRKTQELGGDLATTHLVRGLDRRLLQKARSQQIEPDIPEFTKKESKESFPSENDEQNDKLLEELTEKPSNADQNPSEDAIVNSKNTDVPVYPNGRPMYRRTVEEGKKVNVPLKTTTVPSDVKVPPAERKNQKEPVSLPKVDVETDIFEEAGDDYDPFHEDDDNDNFEPKRIKLEVENKNLQSNDSINFQGKLFEDAKGTAQDSPKDFRQQIQHLANLQSRKENEDMKKLENKKKVDAGFGLTLSKDDTWDITDGDESEDDEDGGKPRKSKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.47
2 0.47
3 0.48
4 0.46
5 0.47
6 0.42
7 0.45
8 0.48
9 0.45
10 0.47
11 0.52
12 0.51
13 0.51
14 0.54
15 0.57
16 0.58
17 0.64
18 0.68
19 0.71
20 0.77
21 0.73
22 0.74
23 0.69
24 0.66
25 0.62
26 0.59
27 0.6
28 0.57
29 0.6
30 0.56
31 0.51
32 0.51
33 0.49
34 0.49
35 0.49
36 0.51
37 0.51
38 0.6
39 0.67
40 0.7
41 0.76
42 0.82
43 0.83
44 0.79
45 0.8
46 0.73
47 0.68
48 0.61
49 0.56
50 0.51
51 0.48
52 0.47
53 0.44
54 0.48
55 0.46
56 0.44
57 0.4
58 0.34
59 0.29
60 0.24
61 0.2
62 0.15
63 0.16
64 0.15
65 0.15
66 0.17
67 0.14
68 0.13
69 0.11
70 0.09
71 0.09
72 0.09
73 0.09
74 0.07
75 0.08
76 0.1
77 0.12
78 0.13
79 0.14
80 0.17
81 0.17
82 0.24
83 0.25
84 0.23
85 0.24
86 0.25
87 0.28
88 0.28
89 0.27
90 0.23
91 0.21
92 0.2
93 0.21
94 0.19
95 0.15
96 0.15
97 0.16
98 0.16
99 0.17
100 0.17
101 0.13
102 0.13
103 0.12
104 0.11
105 0.09
106 0.07
107 0.08
108 0.07
109 0.07
110 0.11
111 0.13
112 0.17
113 0.2
114 0.24
115 0.28
116 0.31
117 0.33
118 0.36
119 0.42
120 0.44
121 0.44
122 0.42
123 0.39
124 0.42
125 0.44
126 0.39
127 0.32
128 0.27
129 0.23
130 0.25
131 0.22
132 0.2
133 0.22
134 0.21
135 0.26
136 0.28
137 0.32
138 0.36
139 0.41
140 0.42
141 0.37
142 0.43
143 0.39
144 0.39
145 0.37
146 0.34
147 0.28
148 0.24
149 0.23
150 0.17
151 0.14
152 0.11
153 0.09
154 0.09
155 0.11
156 0.15
157 0.16
158 0.16
159 0.17
160 0.19
161 0.22
162 0.19
163 0.21
164 0.16
165 0.18
166 0.2
167 0.19
168 0.18
169 0.15
170 0.15
171 0.14
172 0.14
173 0.11
174 0.09
175 0.09
176 0.09
177 0.09
178 0.1
179 0.07
180 0.09
181 0.14
182 0.18
183 0.19
184 0.24
185 0.25
186 0.26
187 0.27
188 0.28
189 0.32
190 0.29
191 0.3
192 0.3
193 0.39
194 0.41
195 0.47
196 0.47
197 0.4
198 0.41
199 0.4
200 0.39
201 0.31
202 0.3
203 0.25
204 0.25
205 0.25
206 0.23
207 0.23
208 0.24
209 0.22
210 0.21
211 0.26
212 0.22
213 0.23
214 0.24
215 0.25
216 0.27
217 0.32
218 0.4
219 0.41
220 0.48
221 0.54
222 0.6
223 0.62
224 0.59
225 0.58
226 0.59
227 0.58
228 0.51
229 0.44
230 0.38
231 0.36
232 0.31
233 0.28
234 0.19
235 0.14
236 0.14
237 0.13
238 0.1
239 0.09
240 0.09
241 0.08
242 0.08
243 0.06
244 0.05
245 0.05
246 0.06
247 0.07
248 0.07
249 0.08
250 0.08
251 0.08
252 0.13
253 0.16
254 0.19
255 0.19
256 0.21
257 0.21
258 0.23
259 0.25
260 0.21
261 0.24
262 0.21
263 0.22
264 0.28
265 0.39
266 0.46
267 0.51
268 0.58
269 0.53
270 0.57
271 0.55
272 0.47
273 0.39
274 0.32
275 0.26
276 0.21
277 0.22
278 0.19
279 0.2
280 0.19
281 0.19
282 0.18
283 0.21
284 0.19
285 0.18
286 0.18
287 0.18
288 0.2
289 0.2
290 0.2
291 0.19
292 0.22
293 0.25
294 0.27
295 0.31
296 0.34
297 0.39
298 0.39
299 0.4
300 0.46
301 0.47
302 0.53
303 0.53
304 0.52
305 0.48
306 0.53
307 0.52
308 0.48
309 0.43
310 0.41
311 0.37
312 0.38
313 0.38
314 0.41
315 0.42
316 0.48
317 0.5
318 0.5
319 0.58
320 0.63
321 0.68
322 0.68
323 0.67
324 0.65
325 0.69
326 0.64
327 0.61
328 0.54
329 0.5
330 0.45
331 0.41
332 0.36
333 0.28
334 0.26
335 0.22
336 0.2
337 0.15
338 0.12
339 0.12
340 0.13
341 0.15
342 0.15
343 0.13
344 0.15
345 0.14
346 0.16
347 0.15
348 0.13
349 0.13
350 0.13
351 0.12
352 0.12
353 0.13
354 0.15
355 0.22
356 0.24