Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

S9XE01

Protein Details
Accession S9XE01    Localization Confidence Medium Confidence Score 11.4
NoLS Segment(s)
PositionSequenceProtein Nature
91-111SSYALKPKKPRSSPKQASPYTHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 23.5, cyto_nucl 13.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR000626  Ubiquitin-like_dom  
IPR029071  Ubiquitin-like_domsf  
IPR013536  WLM_dom  
Gene Ontology GO:0003690  F:double-stranded DNA binding  
GO:0008237  F:metallopeptidase activity  
GO:0070628  F:proteasome binding  
GO:0003697  F:single-stranded DNA binding  
GO:0046914  F:transition metal ion binding  
GO:0006281  P:DNA repair  
GO:0006508  P:proteolysis  
Pfam View protein in Pfam  
PF00240  ubiquitin  
PF08325  WLM  
PROSITE View protein in PROSITE  
PS50053  UBIQUITIN_2  
PS51397  WLM  
Amino Acid Sequences MELRFTYAGNVTSLSFHEEDTIWSAKEKLSQEIGFSPDQIKLLYKGSLSNESKLQDVVKDKAKIMTIVNKNANLINETISQLNSPRKNVASSYALKPKKPRSSPKQASPYTFNQLHVLDYPFKDRALKYLERLRDDAGIQRIMNSHQWTVSLLTEMDPAEHTQHDSKTLGLNHNHGAHIELRLRTDQYDGFRDYKTVKSTLIHELSHNVHGEHDASFWELFRQLTNEADAADVMSKPGRYVSEQATYTPQIDEATDEDQRDHKRDLLLAAAERRKNAKN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.18
2 0.16
3 0.15
4 0.16
5 0.15
6 0.16
7 0.19
8 0.21
9 0.17
10 0.17
11 0.18
12 0.17
13 0.24
14 0.24
15 0.24
16 0.28
17 0.28
18 0.3
19 0.32
20 0.34
21 0.28
22 0.28
23 0.24
24 0.2
25 0.2
26 0.18
27 0.17
28 0.15
29 0.17
30 0.18
31 0.17
32 0.19
33 0.22
34 0.31
35 0.31
36 0.31
37 0.33
38 0.32
39 0.32
40 0.3
41 0.27
42 0.22
43 0.24
44 0.26
45 0.3
46 0.31
47 0.31
48 0.33
49 0.34
50 0.31
51 0.3
52 0.35
53 0.33
54 0.38
55 0.41
56 0.38
57 0.38
58 0.38
59 0.35
60 0.27
61 0.22
62 0.17
63 0.15
64 0.15
65 0.15
66 0.13
67 0.13
68 0.16
69 0.23
70 0.23
71 0.24
72 0.26
73 0.26
74 0.28
75 0.28
76 0.28
77 0.26
78 0.28
79 0.32
80 0.38
81 0.39
82 0.4
83 0.47
84 0.52
85 0.56
86 0.6
87 0.65
88 0.65
89 0.74
90 0.79
91 0.82
92 0.82
93 0.76
94 0.71
95 0.66
96 0.61
97 0.56
98 0.5
99 0.41
100 0.33
101 0.3
102 0.27
103 0.23
104 0.21
105 0.17
106 0.16
107 0.18
108 0.16
109 0.16
110 0.18
111 0.16
112 0.18
113 0.22
114 0.23
115 0.24
116 0.3
117 0.33
118 0.33
119 0.34
120 0.31
121 0.27
122 0.25
123 0.25
124 0.21
125 0.18
126 0.16
127 0.15
128 0.15
129 0.15
130 0.17
131 0.15
132 0.13
133 0.11
134 0.12
135 0.12
136 0.13
137 0.11
138 0.09
139 0.07
140 0.07
141 0.09
142 0.08
143 0.08
144 0.07
145 0.08
146 0.08
147 0.08
148 0.1
149 0.11
150 0.11
151 0.13
152 0.13
153 0.13
154 0.16
155 0.19
156 0.22
157 0.21
158 0.24
159 0.24
160 0.26
161 0.25
162 0.21
163 0.2
164 0.15
165 0.17
166 0.18
167 0.16
168 0.16
169 0.17
170 0.18
171 0.17
172 0.18
173 0.18
174 0.17
175 0.21
176 0.23
177 0.23
178 0.23
179 0.24
180 0.25
181 0.26
182 0.26
183 0.23
184 0.22
185 0.21
186 0.24
187 0.31
188 0.32
189 0.28
190 0.25
191 0.28
192 0.29
193 0.3
194 0.28
195 0.2
196 0.17
197 0.17
198 0.17
199 0.13
200 0.11
201 0.09
202 0.1
203 0.1
204 0.09
205 0.1
206 0.1
207 0.1
208 0.11
209 0.13
210 0.12
211 0.13
212 0.15
213 0.14
214 0.13
215 0.13
216 0.11
217 0.1
218 0.1
219 0.08
220 0.08
221 0.09
222 0.09
223 0.09
224 0.11
225 0.13
226 0.15
227 0.2
228 0.23
229 0.29
230 0.29
231 0.31
232 0.34
233 0.34
234 0.32
235 0.28
236 0.24
237 0.17
238 0.17
239 0.17
240 0.14
241 0.16
242 0.18
243 0.18
244 0.19
245 0.25
246 0.3
247 0.32
248 0.33
249 0.32
250 0.32
251 0.34
252 0.34
253 0.33
254 0.32
255 0.32
256 0.38
257 0.42
258 0.42
259 0.43