Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

S9X8U5

Protein Details
Accession S9X8U5   
Localization Confidence Medium
Confidence Score 13.9
NoLS Segment(s)
PositionSequenceProtein Nature
4-41NWEKLRKKLDSTKSGRIEKKTGKKENLKHKKQVSNGNEHydrophilic
NLS Segment(s)
PositionSequence
9-34RKKLDSTKSGRIEKKTGKKENLKHKK
Subcellular Location(s) nucl 22.5, cyto_nucl 13, cyto 2.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR013520  Exonuclease_RNaseT/DNA_pol3  
IPR037431  REX4_DEDDh_dom  
IPR047021  REXO1/3/4-like  
IPR012337  RNaseH-like_sf  
IPR036397  RNaseH_sf  
Gene Ontology GO:0008408  F:3'-5' exonuclease activity  
GO:0003676  F:nucleic acid binding  
GO:0006364  P:rRNA processing  
Pfam View protein in Pfam  
PF00929  RNase_T  
CDD cd06144  REX4_like  
Amino Acid Sequences MSSNWEKLRKKLDSTKSGRIEKKTGKKENLKHKKQVSNGNERASQDGLQINDTRMKELKDFAREHDLSESQVFDAYGVDAGNLTRKTNLETLGKYIAMDCEMVGVADDMSVLARVSIVNYHGRVVYDTYVRPKERVTDWRTWVSGVKSFHMRDAPPFEKVQKEVADVLENRVLVGHAIQNDLKVLLLSHPRRLIRDTSRFSGFRKLAKGKTPSLKKLAQQVLGRDIQSAQHSSVQDAQATMDLYKHVKKEMDEPYFKRGFKG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.76
2 0.79
3 0.78
4 0.81
5 0.8
6 0.75
7 0.75
8 0.74
9 0.77
10 0.78
11 0.78
12 0.79
13 0.82
14 0.85
15 0.87
16 0.88
17 0.87
18 0.86
19 0.86
20 0.84
21 0.81
22 0.83
23 0.8
24 0.8
25 0.77
26 0.73
27 0.67
28 0.6
29 0.56
30 0.47
31 0.39
32 0.31
33 0.27
34 0.23
35 0.22
36 0.22
37 0.21
38 0.25
39 0.24
40 0.24
41 0.23
42 0.25
43 0.23
44 0.28
45 0.32
46 0.33
47 0.35
48 0.35
49 0.42
50 0.4
51 0.4
52 0.39
53 0.34
54 0.28
55 0.27
56 0.24
57 0.15
58 0.15
59 0.14
60 0.09
61 0.09
62 0.07
63 0.06
64 0.06
65 0.05
66 0.05
67 0.05
68 0.1
69 0.1
70 0.1
71 0.11
72 0.12
73 0.15
74 0.17
75 0.21
76 0.2
77 0.2
78 0.23
79 0.23
80 0.22
81 0.19
82 0.18
83 0.14
84 0.11
85 0.1
86 0.07
87 0.05
88 0.05
89 0.05
90 0.05
91 0.04
92 0.03
93 0.03
94 0.03
95 0.03
96 0.03
97 0.03
98 0.03
99 0.02
100 0.03
101 0.03
102 0.03
103 0.04
104 0.06
105 0.08
106 0.08
107 0.09
108 0.1
109 0.1
110 0.1
111 0.11
112 0.11
113 0.1
114 0.11
115 0.16
116 0.2
117 0.21
118 0.21
119 0.2
120 0.22
121 0.25
122 0.32
123 0.33
124 0.35
125 0.38
126 0.41
127 0.41
128 0.38
129 0.36
130 0.29
131 0.28
132 0.22
133 0.2
134 0.22
135 0.22
136 0.23
137 0.23
138 0.22
139 0.21
140 0.28
141 0.27
142 0.25
143 0.26
144 0.26
145 0.26
146 0.27
147 0.28
148 0.21
149 0.21
150 0.2
151 0.19
152 0.21
153 0.19
154 0.2
155 0.18
156 0.17
157 0.15
158 0.14
159 0.12
160 0.08
161 0.09
162 0.08
163 0.07
164 0.09
165 0.1
166 0.1
167 0.1
168 0.1
169 0.09
170 0.07
171 0.07
172 0.08
173 0.17
174 0.19
175 0.23
176 0.29
177 0.3
178 0.32
179 0.35
180 0.39
181 0.4
182 0.47
183 0.48
184 0.47
185 0.52
186 0.51
187 0.5
188 0.53
189 0.47
190 0.42
191 0.45
192 0.47
193 0.47
194 0.53
195 0.57
196 0.55
197 0.62
198 0.66
199 0.64
200 0.63
201 0.63
202 0.59
203 0.63
204 0.61
205 0.58
206 0.53
207 0.51
208 0.5
209 0.48
210 0.45
211 0.36
212 0.3
213 0.26
214 0.26
215 0.25
216 0.2
217 0.23
218 0.23
219 0.24
220 0.29
221 0.27
222 0.25
223 0.23
224 0.21
225 0.18
226 0.19
227 0.17
228 0.12
229 0.13
230 0.16
231 0.21
232 0.22
233 0.24
234 0.26
235 0.28
236 0.36
237 0.44
238 0.49
239 0.54
240 0.55
241 0.6
242 0.64