Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

S9W8S7

Protein Details
Accession S9W8S7    Localization Confidence Low Confidence Score 7.3
NoLS Segment(s)
PositionSequenceProtein Nature
265-289MWVWAQKKHKRYLKEFPNYPKSRKVHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 14.5, mito_nucl 13.166, nucl 10.5, cyto_nucl 6.833
Family & Domain DBs
InterPro View protein in InterPro  
IPR001104  3-oxo-5_a-steroid_4-DH_C  
IPR039357  SRD5A/TECR  
IPR000626  Ubiquitin-like_dom  
IPR029071  Ubiquitin-like_domsf  
Gene Ontology GO:0005789  C:endoplasmic reticulum membrane  
GO:0016627  F:oxidoreductase activity, acting on the CH-CH group of donors  
GO:0000038  P:very long-chain fatty acid metabolic process  
Pfam View protein in Pfam  
PF02544  Steroid_dh  
PF00240  ubiquitin  
PROSITE View protein in PROSITE  
PS50244  S5A_REDUCTASE  
PS50053  UBIQUITIN_2  
Amino Acid Sequences MSISLASRGRKIKYLPKNLEFPLDGSIDQLKEEISQKSQLPIERLRLSTVDGTVLLPGKTLRKYGIGPGTTIWVKDLGPQIGWRTVYIIEYLGPLIIHSLFVLNLKHIYRQEFNLSLNQKIAFVMVILHFLKREYESIYVHRFSSATMPFRNIFKNCFHYHVLAGVLLAFFIYGPWHSQDYISPKLLIFYTFGWTFSVLSNLKMHLKLRDLRPEGSSKRAIPYGYGFNWVSCPNYFFESLEWLLFALITRSWASWLFLAIGSAQMWVWAQKKHKRYLKEFPNYPKSRKVFIPFFM
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.65
2 0.68
3 0.68
4 0.72
5 0.68
6 0.68
7 0.58
8 0.49
9 0.42
10 0.34
11 0.27
12 0.23
13 0.24
14 0.18
15 0.17
16 0.16
17 0.13
18 0.14
19 0.18
20 0.18
21 0.18
22 0.22
23 0.23
24 0.28
25 0.31
26 0.32
27 0.34
28 0.36
29 0.41
30 0.41
31 0.41
32 0.39
33 0.36
34 0.35
35 0.32
36 0.27
37 0.2
38 0.16
39 0.15
40 0.15
41 0.16
42 0.13
43 0.11
44 0.12
45 0.15
46 0.17
47 0.18
48 0.18
49 0.19
50 0.21
51 0.27
52 0.34
53 0.3
54 0.29
55 0.28
56 0.31
57 0.28
58 0.27
59 0.2
60 0.14
61 0.13
62 0.16
63 0.2
64 0.16
65 0.16
66 0.18
67 0.2
68 0.22
69 0.23
70 0.18
71 0.16
72 0.15
73 0.15
74 0.14
75 0.12
76 0.08
77 0.08
78 0.08
79 0.07
80 0.06
81 0.05
82 0.06
83 0.05
84 0.05
85 0.05
86 0.05
87 0.05
88 0.07
89 0.07
90 0.07
91 0.1
92 0.1
93 0.14
94 0.15
95 0.19
96 0.19
97 0.22
98 0.25
99 0.24
100 0.25
101 0.28
102 0.28
103 0.25
104 0.25
105 0.22
106 0.18
107 0.16
108 0.15
109 0.08
110 0.06
111 0.07
112 0.05
113 0.08
114 0.08
115 0.08
116 0.08
117 0.09
118 0.1
119 0.09
120 0.1
121 0.09
122 0.11
123 0.13
124 0.17
125 0.2
126 0.2
127 0.2
128 0.19
129 0.17
130 0.15
131 0.18
132 0.18
133 0.17
134 0.17
135 0.19
136 0.19
137 0.21
138 0.25
139 0.21
140 0.21
141 0.21
142 0.27
143 0.26
144 0.29
145 0.29
146 0.26
147 0.25
148 0.23
149 0.2
150 0.14
151 0.12
152 0.08
153 0.06
154 0.05
155 0.04
156 0.03
157 0.02
158 0.02
159 0.03
160 0.03
161 0.04
162 0.06
163 0.07
164 0.08
165 0.08
166 0.12
167 0.17
168 0.21
169 0.21
170 0.2
171 0.19
172 0.2
173 0.2
174 0.17
175 0.13
176 0.1
177 0.13
178 0.12
179 0.13
180 0.12
181 0.13
182 0.13
183 0.11
184 0.16
185 0.12
186 0.14
187 0.14
188 0.16
189 0.18
190 0.2
191 0.21
192 0.19
193 0.24
194 0.28
195 0.33
196 0.41
197 0.42
198 0.42
199 0.44
200 0.48
201 0.46
202 0.45
203 0.44
204 0.36
205 0.36
206 0.36
207 0.33
208 0.27
209 0.28
210 0.28
211 0.25
212 0.28
213 0.25
214 0.23
215 0.25
216 0.24
217 0.23
218 0.17
219 0.18
220 0.15
221 0.18
222 0.18
223 0.16
224 0.16
225 0.19
226 0.19
227 0.17
228 0.16
229 0.13
230 0.12
231 0.11
232 0.1
233 0.07
234 0.06
235 0.08
236 0.09
237 0.09
238 0.11
239 0.12
240 0.13
241 0.12
242 0.13
243 0.12
244 0.12
245 0.12
246 0.1
247 0.11
248 0.09
249 0.09
250 0.08
251 0.07
252 0.08
253 0.11
254 0.14
255 0.19
256 0.28
257 0.36
258 0.44
259 0.54
260 0.61
261 0.67
262 0.72
263 0.78
264 0.8
265 0.82
266 0.83
267 0.83
268 0.86
269 0.84
270 0.81
271 0.8
272 0.74
273 0.68
274 0.67
275 0.66