Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

S9XFZ2

Protein Details
Accession S9XFZ2   
Localization Confidence Low
Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
1-21MGKRKASKRIRPTRRAAPLETHydrophilic
NLS Segment(s)
PositionSequence
3-15KRKASKRIRPTRR
Subcellular Location(s) mito 23.5, cyto_mito 13.166
Family & Domain DBs
InterPro View protein in InterPro  
IPR007808  Elf1  
IPR038567  T_Elf1_sf  
Gene Ontology GO:0008023  C:transcription elongation factor complex  
GO:0046872  F:metal ion binding  
GO:0000993  F:RNA polymerase II complex binding  
GO:0003746  F:translation elongation factor activity  
GO:0006368  P:transcription elongation by RNA polymerase II  
GO:0045815  P:transcription initiation-coupled chromatin remodeling  
Pfam View protein in Pfam  
PF05129  Elf1  
Amino Acid Sequences MGKRKASKRIRPTRRAAPLETTSVSCTLDKQSGVGNLHCKICGQSHQCIITALSAPIDVYSDWIDACDTVAHQAQDDKGGDGNGASADVRADNEGNYSGDEGY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.87
2 0.82
3 0.75
4 0.71
5 0.63
6 0.59
7 0.52
8 0.43
9 0.34
10 0.3
11 0.27
12 0.2
13 0.18
14 0.16
15 0.17
16 0.15
17 0.14
18 0.15
19 0.19
20 0.2
21 0.21
22 0.22
23 0.22
24 0.23
25 0.23
26 0.2
27 0.17
28 0.17
29 0.22
30 0.21
31 0.22
32 0.25
33 0.26
34 0.26
35 0.25
36 0.24
37 0.18
38 0.15
39 0.11
40 0.07
41 0.06
42 0.06
43 0.05
44 0.06
45 0.04
46 0.05
47 0.06
48 0.06
49 0.06
50 0.06
51 0.06
52 0.06
53 0.06
54 0.05
55 0.04
56 0.07
57 0.09
58 0.09
59 0.09
60 0.11
61 0.11
62 0.15
63 0.15
64 0.14
65 0.13
66 0.13
67 0.12
68 0.11
69 0.11
70 0.07
71 0.07
72 0.06
73 0.05
74 0.06
75 0.06
76 0.07
77 0.09
78 0.09
79 0.09
80 0.11
81 0.13
82 0.13
83 0.13