Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

S9X2U5

Protein Details
Accession S9X2U5    Localization Confidence Low Confidence Score 9.3
NoLS Segment(s)
PositionSequenceProtein Nature
1-21MAPKKKWSKGKVKDKAQHATVHydrophilic
NLS Segment(s)
PositionSequence
4-12KKKWSKGKV
Subcellular Location(s) cyto 13.5, cyto_nucl 9.5, mito 7, nucl 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR004977  Ribosomal_S25  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
Pfam View protein in Pfam  
PF03297  Ribosomal_S25  
Amino Acid Sequences MAPKKKWSKGKVKDKAQHATVFDKNLIDRINKEVPAFKFVSVSVLVDRMKINGALARIAIKDLAERGVINKVDHSSKQYIYTRVPATSA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.86
2 0.84
3 0.77
4 0.71
5 0.63
6 0.59
7 0.51
8 0.46
9 0.39
10 0.32
11 0.27
12 0.25
13 0.24
14 0.19
15 0.18
16 0.21
17 0.24
18 0.24
19 0.24
20 0.27
21 0.26
22 0.29
23 0.29
24 0.23
25 0.2
26 0.18
27 0.2
28 0.14
29 0.13
30 0.09
31 0.1
32 0.1
33 0.1
34 0.1
35 0.09
36 0.09
37 0.08
38 0.09
39 0.08
40 0.08
41 0.08
42 0.08
43 0.09
44 0.08
45 0.09
46 0.08
47 0.07
48 0.07
49 0.07
50 0.08
51 0.08
52 0.08
53 0.09
54 0.15
55 0.16
56 0.16
57 0.17
58 0.19
59 0.23
60 0.24
61 0.29
62 0.28
63 0.28
64 0.35
65 0.38
66 0.4
67 0.4
68 0.46
69 0.43