Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

S9X726

Protein Details
Accession S9X726   
Localization Confidence Low
Confidence Score 9.5
NoLS Segment(s)
PositionSequenceProtein Nature
398-419DETLRFWKLFNKKPKQESSLIRHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 16.5, cyto_nucl 11.5, cyto 5.5, mito 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR033010  Cdc20/Fizzy  
IPR015943  WD40/YVTN_repeat-like_dom_sf  
IPR001680  WD40_repeat  
IPR036322  WD40_repeat_dom_sf  
Gene Ontology GO:0010997  F:anaphase-promoting complex binding  
GO:1990757  F:ubiquitin ligase activator activity  
GO:0031145  P:anaphase-promoting complex-dependent catabolic process  
GO:1990950  P:metaphase/anaphase transition of meiosis II  
GO:0075296  P:positive regulation of ascospore formation  
Pfam View protein in Pfam  
PF00400  WD40  
PROSITE View protein in PROSITE  
PS50082  WD_REPEATS_2  
PS50294  WD_REPEATS_REGION  
Amino Acid Sequences MGDRFIPIRNVSNEFDISFESIRKTISEGTSLRRKSSGSVQRQFMELLSIELFGNKQVASRTFRYGDLKEKSEKSYFDIPTRNSYSLSPISPQSQDLLLRPPKPKRVFPKAPYKVLDAPYLEDDFYLNLLSWGRSNILAVGLASSVYLWSANSGKVVKLHDFGEANNVTSVLWTGIGTNIAVGTDSGFIHIWDTECTKPIRSLRGHSKRVAALASNGNTLTSGGKDEMLAHHDLRQSECYLKVKGHDQEICGLQWESNLGQLASGGNDNKLVVWDYRTTRPLHTFLEHSAAVKAIGWSPHQRGILASGGGTVDRSLMIHNTLTGKLQNRLDTGSQVCNLAWSKTSNEIVTTHGYAKNQVSLWKYPTLSNVVNLTGHTNRVLHLSMSPDGQSIVTGAGDETLRFWKLFNKKPKQESSLIR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.34
2 0.32
3 0.26
4 0.25
5 0.21
6 0.2
7 0.19
8 0.18
9 0.19
10 0.18
11 0.19
12 0.22
13 0.23
14 0.28
15 0.28
16 0.35
17 0.44
18 0.45
19 0.45
20 0.41
21 0.4
22 0.37
23 0.45
24 0.47
25 0.48
26 0.54
27 0.57
28 0.56
29 0.57
30 0.53
31 0.43
32 0.36
33 0.25
34 0.19
35 0.14
36 0.14
37 0.12
38 0.13
39 0.12
40 0.1
41 0.11
42 0.09
43 0.1
44 0.13
45 0.18
46 0.24
47 0.27
48 0.32
49 0.33
50 0.37
51 0.41
52 0.41
53 0.45
54 0.45
55 0.46
56 0.47
57 0.49
58 0.5
59 0.49
60 0.46
61 0.43
62 0.46
63 0.45
64 0.44
65 0.48
66 0.45
67 0.49
68 0.53
69 0.48
70 0.4
71 0.37
72 0.37
73 0.33
74 0.32
75 0.26
76 0.24
77 0.26
78 0.26
79 0.26
80 0.21
81 0.2
82 0.2
83 0.2
84 0.26
85 0.29
86 0.34
87 0.4
88 0.45
89 0.53
90 0.57
91 0.64
92 0.65
93 0.7
94 0.74
95 0.74
96 0.79
97 0.77
98 0.78
99 0.72
100 0.68
101 0.63
102 0.55
103 0.52
104 0.41
105 0.36
106 0.31
107 0.3
108 0.24
109 0.18
110 0.15
111 0.11
112 0.11
113 0.09
114 0.06
115 0.06
116 0.07
117 0.07
118 0.07
119 0.08
120 0.08
121 0.08
122 0.09
123 0.08
124 0.08
125 0.08
126 0.07
127 0.06
128 0.05
129 0.05
130 0.05
131 0.04
132 0.04
133 0.03
134 0.04
135 0.03
136 0.05
137 0.06
138 0.07
139 0.09
140 0.1
141 0.1
142 0.13
143 0.16
144 0.16
145 0.17
146 0.17
147 0.18
148 0.18
149 0.17
150 0.21
151 0.19
152 0.18
153 0.16
154 0.16
155 0.12
156 0.12
157 0.12
158 0.05
159 0.05
160 0.04
161 0.04
162 0.05
163 0.05
164 0.05
165 0.05
166 0.04
167 0.04
168 0.04
169 0.03
170 0.04
171 0.04
172 0.05
173 0.06
174 0.06
175 0.06
176 0.06
177 0.07
178 0.07
179 0.07
180 0.1
181 0.09
182 0.12
183 0.12
184 0.13
185 0.17
186 0.19
187 0.25
188 0.24
189 0.3
190 0.39
191 0.48
192 0.52
193 0.5
194 0.51
195 0.44
196 0.43
197 0.38
198 0.27
199 0.2
200 0.2
201 0.18
202 0.15
203 0.14
204 0.13
205 0.12
206 0.12
207 0.09
208 0.06
209 0.06
210 0.06
211 0.06
212 0.06
213 0.07
214 0.07
215 0.1
216 0.11
217 0.1
218 0.13
219 0.15
220 0.16
221 0.17
222 0.18
223 0.17
224 0.16
225 0.19
226 0.19
227 0.18
228 0.18
229 0.18
230 0.23
231 0.24
232 0.28
233 0.27
234 0.25
235 0.28
236 0.28
237 0.26
238 0.22
239 0.19
240 0.13
241 0.11
242 0.12
243 0.09
244 0.09
245 0.09
246 0.07
247 0.07
248 0.07
249 0.07
250 0.06
251 0.08
252 0.07
253 0.07
254 0.07
255 0.07
256 0.07
257 0.08
258 0.09
259 0.08
260 0.1
261 0.14
262 0.17
263 0.22
264 0.25
265 0.26
266 0.28
267 0.32
268 0.33
269 0.32
270 0.3
271 0.28
272 0.26
273 0.29
274 0.26
275 0.22
276 0.19
277 0.16
278 0.14
279 0.12
280 0.12
281 0.09
282 0.1
283 0.13
284 0.17
285 0.2
286 0.25
287 0.25
288 0.24
289 0.23
290 0.24
291 0.24
292 0.19
293 0.16
294 0.11
295 0.11
296 0.11
297 0.1
298 0.07
299 0.05
300 0.05
301 0.05
302 0.06
303 0.07
304 0.08
305 0.08
306 0.1
307 0.12
308 0.13
309 0.14
310 0.17
311 0.2
312 0.24
313 0.27
314 0.28
315 0.27
316 0.3
317 0.29
318 0.3
319 0.3
320 0.27
321 0.25
322 0.23
323 0.21
324 0.22
325 0.22
326 0.19
327 0.18
328 0.17
329 0.19
330 0.23
331 0.26
332 0.22
333 0.23
334 0.22
335 0.23
336 0.25
337 0.25
338 0.23
339 0.24
340 0.24
341 0.26
342 0.27
343 0.28
344 0.26
345 0.28
346 0.29
347 0.31
348 0.34
349 0.36
350 0.36
351 0.33
352 0.35
353 0.37
354 0.33
355 0.32
356 0.3
357 0.27
358 0.26
359 0.25
360 0.26
361 0.22
362 0.22
363 0.2
364 0.19
365 0.17
366 0.2
367 0.21
368 0.17
369 0.17
370 0.2
371 0.19
372 0.21
373 0.21
374 0.18
375 0.17
376 0.16
377 0.14
378 0.1
379 0.1
380 0.08
381 0.07
382 0.07
383 0.08
384 0.08
385 0.08
386 0.1
387 0.13
388 0.15
389 0.14
390 0.15
391 0.22
392 0.32
393 0.42
394 0.51
395 0.58
396 0.66
397 0.76
398 0.85
399 0.83