Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

S9W811

Protein Details
Accession S9W811   
Localization Confidence High
Confidence Score 18.2
NoLS Segment(s)
PositionSequenceProtein Nature
15-41SFNFLSCKRIMPRRQTTKRTRVQSYESHydrophilic
87-112TIEPAAPRLRRSRRDRKPVDYRTESDHydrophilic
161-181VIKRKRSTSSTRKVSKKNLLEHydrophilic
532-564YYPPGAHRRLIARKQRKKKSKNNKEEVKDDEETBasic
NLS Segment(s)
PositionSequence
96-101RRSRRD
538-554HRRLIARKQRKKKSKNN
Subcellular Location(s) mito 13.5mito_nucl 13.5, nucl 12.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR004601  UvdE  
IPR036237  Xyl_isomerase-like_sf  
Gene Ontology GO:0005739  C:mitochondrion  
GO:0005634  C:nucleus  
GO:1990043  F:5' deoxyribonuclease (pyrimidine dimer) activity  
GO:0000404  F:heteroduplex DNA loop binding  
GO:0006284  P:base-excision repair  
GO:0006298  P:mismatch repair  
GO:0043504  P:mitochondrial DNA repair  
GO:0006289  P:nucleotide-excision repair  
GO:0006290  P:pyrimidine dimer repair  
GO:0070914  P:UV-damage excision repair  
Pfam View protein in Pfam  
PF03851  UvdE  
Amino Acid Sequences MLLLLRGFHPYRVLSFNFLSCKRIMPRRQTTKRTRVQSYESISIPSSNAHIQDEVIKAKTSRHRYQAVHNGPSNNHTSSPAEEIAPTIEPAAPRLRRSRRDRKPVDYRTESDNETEDDDPLLSRIETKAYPNEGSEASVTTESDSSAYELDGPETLLSKDVIKRKRSTSSTRKVSKKNLLEDSELSEEPQASRPIFDCPDKPLPWKGRLGYACQNTVLRFSREIAFCSRTCRIATIQKESLQFAKDLGIKNTQDLATLVEWNHRFGIHFMRVSSDLFPFASHGTYGYSLEFADSYLQAVGELANRYNHRLSTHPGQYTQIASPKESVVTNAIRDLRYHEELLSRMKLNEQLNRDAVIILHLGGSFEGKEETLNRFRDNYVRLPEAVKMRLVLENDDVTWSVQDLLPLCQELSIPLVLDWHHHNVVPGTLREGSLDLMPLLPAIRETWTRKGITQKQHYSESAYPFAISAMKRRGHSDRVYSLPPCEPDMDLMIEAKEKEQAIFELSRIFNLTNPSCPKEIEGPDFDVFNEGYYPPGAHRRLIARKQRKKKSKNNKEEVKDDEETNTKDELVT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.29
2 0.31
3 0.35
4 0.38
5 0.38
6 0.38
7 0.33
8 0.38
9 0.41
10 0.48
11 0.52
12 0.56
13 0.65
14 0.73
15 0.83
16 0.87
17 0.9
18 0.91
19 0.91
20 0.89
21 0.86
22 0.82
23 0.79
24 0.77
25 0.73
26 0.67
27 0.59
28 0.52
29 0.45
30 0.39
31 0.32
32 0.24
33 0.2
34 0.18
35 0.19
36 0.18
37 0.18
38 0.17
39 0.22
40 0.25
41 0.25
42 0.23
43 0.24
44 0.23
45 0.3
46 0.38
47 0.43
48 0.47
49 0.51
50 0.58
51 0.59
52 0.69
53 0.72
54 0.72
55 0.71
56 0.67
57 0.64
58 0.57
59 0.58
60 0.52
61 0.43
62 0.35
63 0.3
64 0.28
65 0.26
66 0.29
67 0.26
68 0.22
69 0.2
70 0.2
71 0.19
72 0.17
73 0.15
74 0.11
75 0.12
76 0.11
77 0.14
78 0.22
79 0.23
80 0.27
81 0.37
82 0.46
83 0.54
84 0.64
85 0.73
86 0.75
87 0.83
88 0.87
89 0.87
90 0.88
91 0.88
92 0.88
93 0.84
94 0.76
95 0.71
96 0.67
97 0.58
98 0.49
99 0.41
100 0.32
101 0.28
102 0.26
103 0.19
104 0.16
105 0.15
106 0.13
107 0.11
108 0.11
109 0.08
110 0.09
111 0.09
112 0.11
113 0.12
114 0.16
115 0.21
116 0.24
117 0.25
118 0.24
119 0.26
120 0.23
121 0.23
122 0.21
123 0.16
124 0.14
125 0.13
126 0.12
127 0.11
128 0.11
129 0.1
130 0.09
131 0.09
132 0.08
133 0.08
134 0.08
135 0.08
136 0.08
137 0.08
138 0.08
139 0.08
140 0.07
141 0.08
142 0.08
143 0.08
144 0.08
145 0.1
146 0.16
147 0.23
148 0.3
149 0.35
150 0.4
151 0.44
152 0.53
153 0.57
154 0.62
155 0.65
156 0.68
157 0.72
158 0.77
159 0.8
160 0.79
161 0.81
162 0.8
163 0.77
164 0.74
165 0.72
166 0.66
167 0.6
168 0.54
169 0.49
170 0.43
171 0.35
172 0.28
173 0.21
174 0.18
175 0.16
176 0.18
177 0.17
178 0.13
179 0.14
180 0.14
181 0.18
182 0.2
183 0.22
184 0.2
185 0.24
186 0.31
187 0.32
188 0.35
189 0.39
190 0.41
191 0.43
192 0.46
193 0.41
194 0.41
195 0.41
196 0.43
197 0.43
198 0.41
199 0.38
200 0.34
201 0.35
202 0.27
203 0.31
204 0.27
205 0.21
206 0.19
207 0.2
208 0.24
209 0.23
210 0.25
211 0.24
212 0.25
213 0.24
214 0.28
215 0.28
216 0.24
217 0.24
218 0.24
219 0.23
220 0.28
221 0.31
222 0.33
223 0.35
224 0.37
225 0.38
226 0.37
227 0.35
228 0.28
229 0.24
230 0.18
231 0.18
232 0.17
233 0.17
234 0.18
235 0.21
236 0.2
237 0.21
238 0.23
239 0.19
240 0.16
241 0.15
242 0.15
243 0.1
244 0.12
245 0.11
246 0.14
247 0.14
248 0.15
249 0.15
250 0.13
251 0.13
252 0.13
253 0.18
254 0.16
255 0.17
256 0.16
257 0.17
258 0.18
259 0.19
260 0.19
261 0.13
262 0.11
263 0.1
264 0.1
265 0.09
266 0.08
267 0.08
268 0.06
269 0.06
270 0.06
271 0.07
272 0.07
273 0.07
274 0.06
275 0.06
276 0.06
277 0.06
278 0.05
279 0.05
280 0.05
281 0.05
282 0.05
283 0.05
284 0.04
285 0.04
286 0.05
287 0.06
288 0.06
289 0.07
290 0.1
291 0.1
292 0.13
293 0.14
294 0.15
295 0.14
296 0.16
297 0.2
298 0.25
299 0.3
300 0.29
301 0.29
302 0.29
303 0.29
304 0.29
305 0.26
306 0.24
307 0.19
308 0.18
309 0.18
310 0.17
311 0.17
312 0.15
313 0.14
314 0.13
315 0.14
316 0.13
317 0.15
318 0.17
319 0.16
320 0.17
321 0.2
322 0.21
323 0.22
324 0.22
325 0.2
326 0.19
327 0.21
328 0.24
329 0.22
330 0.18
331 0.16
332 0.17
333 0.22
334 0.23
335 0.27
336 0.27
337 0.28
338 0.29
339 0.3
340 0.29
341 0.23
342 0.19
343 0.15
344 0.11
345 0.08
346 0.07
347 0.06
348 0.05
349 0.05
350 0.06
351 0.05
352 0.05
353 0.05
354 0.04
355 0.05
356 0.08
357 0.13
358 0.19
359 0.21
360 0.22
361 0.24
362 0.25
363 0.3
364 0.31
365 0.32
366 0.3
367 0.3
368 0.3
369 0.29
370 0.32
371 0.31
372 0.29
373 0.23
374 0.19
375 0.19
376 0.21
377 0.2
378 0.18
379 0.16
380 0.15
381 0.15
382 0.15
383 0.14
384 0.11
385 0.1
386 0.09
387 0.08
388 0.07
389 0.09
390 0.09
391 0.1
392 0.1
393 0.11
394 0.1
395 0.09
396 0.09
397 0.08
398 0.09
399 0.08
400 0.07
401 0.07
402 0.08
403 0.08
404 0.1
405 0.13
406 0.15
407 0.16
408 0.16
409 0.17
410 0.17
411 0.2
412 0.21
413 0.18
414 0.17
415 0.17
416 0.17
417 0.16
418 0.16
419 0.14
420 0.11
421 0.11
422 0.08
423 0.08
424 0.07
425 0.07
426 0.06
427 0.05
428 0.06
429 0.06
430 0.08
431 0.14
432 0.19
433 0.25
434 0.31
435 0.32
436 0.35
437 0.45
438 0.51
439 0.56
440 0.61
441 0.63
442 0.63
443 0.67
444 0.64
445 0.61
446 0.57
447 0.52
448 0.45
449 0.37
450 0.32
451 0.26
452 0.26
453 0.23
454 0.19
455 0.2
456 0.25
457 0.29
458 0.3
459 0.36
460 0.41
461 0.44
462 0.49
463 0.5
464 0.49
465 0.49
466 0.53
467 0.49
468 0.47
469 0.44
470 0.4
471 0.34
472 0.3
473 0.25
474 0.22
475 0.23
476 0.21
477 0.17
478 0.16
479 0.15
480 0.15
481 0.15
482 0.14
483 0.15
484 0.13
485 0.13
486 0.14
487 0.14
488 0.17
489 0.18
490 0.18
491 0.21
492 0.21
493 0.21
494 0.22
495 0.21
496 0.19
497 0.26
498 0.27
499 0.28
500 0.34
501 0.37
502 0.36
503 0.36
504 0.38
505 0.38
506 0.42
507 0.4
508 0.39
509 0.4
510 0.4
511 0.39
512 0.36
513 0.3
514 0.24
515 0.19
516 0.16
517 0.11
518 0.11
519 0.12
520 0.13
521 0.13
522 0.22
523 0.24
524 0.23
525 0.28
526 0.37
527 0.46
528 0.56
529 0.64
530 0.66
531 0.75
532 0.85
533 0.91
534 0.92
535 0.93
536 0.94
537 0.95
538 0.95
539 0.95
540 0.95
541 0.95
542 0.91
543 0.88
544 0.84
545 0.8
546 0.72
547 0.62
548 0.56
549 0.52
550 0.47
551 0.42
552 0.36