Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

S9XAV8

Protein Details
Accession S9XAV8    Localization Confidence Low Confidence Score 9.1
NoLS Segment(s)
PositionSequenceProtein Nature
386-408NVKSLVDRKAKRDKGQQQNSTKRHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 15.5, cyto_nucl 13, cyto 7.5, mito 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR007240  Atg17  
IPR045326  ATG17-like_dom  
Gene Ontology GO:0034045  C:phagophore assembly site membrane  
GO:0016301  F:kinase activity  
GO:0000422  P:autophagy of mitochondrion  
GO:0016236  P:macroautophagy  
GO:0016310  P:phosphorylation  
Pfam View protein in Pfam  
PF04108  ATG17_like  
Amino Acid Sequences MDLLKQWTEQAKVALTEARQLCGDAHEYNEDAKNCLKNSVKQHQQLSELAKLTASQCARLDSSTSLIKQLLNLVQNHPTFGQLNDLHDRLELSLKRLRECVLDPALGSEYPNLYSFVDDASLEDLKTRLRRVTDGVWNAYEKLSGLLEEDICEQYHIRLGAISLDFLPPVNNDIAETLAELLLQVAQHYDQCSEALTIYSGLSDVEKKELIEILRYDSNHVPSVLRDLRTGLEETKTYHSTVLRYKQNVDASTKKLEQLAEELNKNQLTNRRHEAAHELMSAHTGLEIPQLAQELIQLERHYTQFAKSYYALLQEIHRRQAYEKRVRSVVDSLVYKLEQEQQTETKARIDFCTQYGDYLPQTLWNAVTDPPLHFEIIEHQYTELPNVKSLVDRKAKRDKGQQQNSTKR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.28
2 0.24
3 0.29
4 0.28
5 0.27
6 0.24
7 0.24
8 0.23
9 0.21
10 0.25
11 0.17
12 0.19
13 0.19
14 0.2
15 0.23
16 0.28
17 0.26
18 0.25
19 0.28
20 0.31
21 0.29
22 0.36
23 0.38
24 0.39
25 0.48
26 0.56
27 0.61
28 0.63
29 0.69
30 0.66
31 0.65
32 0.63
33 0.58
34 0.54
35 0.46
36 0.39
37 0.32
38 0.29
39 0.26
40 0.27
41 0.23
42 0.2
43 0.2
44 0.23
45 0.24
46 0.23
47 0.25
48 0.19
49 0.22
50 0.23
51 0.23
52 0.22
53 0.22
54 0.22
55 0.2
56 0.24
57 0.24
58 0.24
59 0.26
60 0.26
61 0.32
62 0.32
63 0.33
64 0.28
65 0.26
66 0.22
67 0.2
68 0.25
69 0.2
70 0.24
71 0.27
72 0.27
73 0.25
74 0.24
75 0.24
76 0.18
77 0.23
78 0.2
79 0.2
80 0.24
81 0.25
82 0.27
83 0.28
84 0.28
85 0.24
86 0.25
87 0.28
88 0.27
89 0.26
90 0.24
91 0.24
92 0.24
93 0.21
94 0.19
95 0.13
96 0.11
97 0.11
98 0.12
99 0.12
100 0.1
101 0.11
102 0.1
103 0.09
104 0.09
105 0.08
106 0.08
107 0.09
108 0.09
109 0.09
110 0.09
111 0.1
112 0.12
113 0.15
114 0.17
115 0.18
116 0.19
117 0.21
118 0.25
119 0.31
120 0.35
121 0.37
122 0.37
123 0.35
124 0.34
125 0.33
126 0.29
127 0.22
128 0.14
129 0.11
130 0.09
131 0.07
132 0.07
133 0.08
134 0.08
135 0.08
136 0.1
137 0.09
138 0.09
139 0.1
140 0.09
141 0.08
142 0.1
143 0.1
144 0.08
145 0.07
146 0.07
147 0.1
148 0.1
149 0.1
150 0.08
151 0.08
152 0.08
153 0.08
154 0.08
155 0.05
156 0.07
157 0.07
158 0.06
159 0.06
160 0.07
161 0.07
162 0.07
163 0.07
164 0.05
165 0.05
166 0.04
167 0.04
168 0.04
169 0.04
170 0.04
171 0.04
172 0.03
173 0.04
174 0.05
175 0.06
176 0.06
177 0.06
178 0.06
179 0.07
180 0.07
181 0.07
182 0.06
183 0.06
184 0.06
185 0.05
186 0.05
187 0.05
188 0.04
189 0.05
190 0.05
191 0.06
192 0.07
193 0.07
194 0.07
195 0.07
196 0.1
197 0.09
198 0.1
199 0.1
200 0.12
201 0.14
202 0.14
203 0.17
204 0.17
205 0.19
206 0.18
207 0.18
208 0.15
209 0.13
210 0.2
211 0.2
212 0.19
213 0.17
214 0.18
215 0.18
216 0.19
217 0.2
218 0.14
219 0.12
220 0.12
221 0.14
222 0.18
223 0.18
224 0.17
225 0.18
226 0.18
227 0.2
228 0.25
229 0.31
230 0.32
231 0.33
232 0.35
233 0.38
234 0.41
235 0.4
236 0.4
237 0.37
238 0.34
239 0.38
240 0.36
241 0.32
242 0.3
243 0.28
244 0.23
245 0.22
246 0.24
247 0.23
248 0.24
249 0.23
250 0.25
251 0.25
252 0.24
253 0.23
254 0.25
255 0.25
256 0.29
257 0.34
258 0.34
259 0.34
260 0.35
261 0.38
262 0.34
263 0.33
264 0.28
265 0.23
266 0.2
267 0.2
268 0.19
269 0.13
270 0.09
271 0.06
272 0.05
273 0.06
274 0.07
275 0.06
276 0.07
277 0.08
278 0.07
279 0.07
280 0.08
281 0.08
282 0.09
283 0.11
284 0.1
285 0.11
286 0.14
287 0.14
288 0.15
289 0.15
290 0.16
291 0.2
292 0.2
293 0.23
294 0.21
295 0.23
296 0.23
297 0.25
298 0.23
299 0.18
300 0.22
301 0.27
302 0.3
303 0.34
304 0.33
305 0.32
306 0.34
307 0.42
308 0.48
309 0.5
310 0.52
311 0.52
312 0.54
313 0.54
314 0.54
315 0.5
316 0.43
317 0.38
318 0.33
319 0.29
320 0.29
321 0.28
322 0.24
323 0.22
324 0.26
325 0.23
326 0.23
327 0.27
328 0.26
329 0.32
330 0.34
331 0.33
332 0.31
333 0.31
334 0.3
335 0.29
336 0.32
337 0.29
338 0.28
339 0.35
340 0.29
341 0.28
342 0.28
343 0.28
344 0.23
345 0.23
346 0.21
347 0.17
348 0.19
349 0.19
350 0.18
351 0.16
352 0.16
353 0.16
354 0.2
355 0.18
356 0.17
357 0.2
358 0.21
359 0.2
360 0.18
361 0.18
362 0.22
363 0.25
364 0.26
365 0.22
366 0.21
367 0.24
368 0.24
369 0.28
370 0.28
371 0.23
372 0.24
373 0.24
374 0.25
375 0.28
376 0.32
377 0.37
378 0.4
379 0.44
380 0.51
381 0.61
382 0.68
383 0.71
384 0.78
385 0.79
386 0.8
387 0.86
388 0.88