Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

S9XB66

Protein Details
Accession S9XB66    Localization Confidence Medium Confidence Score 10
NoLS Segment(s)
PositionSequenceProtein Nature
86-106HSSHTHKQPLKQKSSNRLMSMHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 19.5, cyto_nucl 14, cyto 5.5
Family & Domain DBs
Gene Ontology GO:1990948  F:ubiquitin ligase inhibitor activity  
GO:1990946  P:meiosis I/meiosis II transition  
GO:1990949  P:metaphase/anaphase transition of meiosis I  
GO:1902103  P:negative regulation of metaphase/anaphase transition of meiotic cell cycle  
Amino Acid Sequences MLNLDNKENEVPFFAKKEPESPPALYRVQRPLLRRPLQELSIEMVPPPSSTSGKGVVESPKKAAKKPLAPSHGFHPYKISTKVLPHSSHTHKQPLKQKSSNRLMSMR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.22
2 0.25
3 0.26
4 0.3
5 0.32
6 0.34
7 0.37
8 0.36
9 0.36
10 0.36
11 0.39
12 0.36
13 0.36
14 0.38
15 0.4
16 0.41
17 0.43
18 0.47
19 0.53
20 0.57
21 0.54
22 0.53
23 0.5
24 0.48
25 0.44
26 0.36
27 0.29
28 0.24
29 0.23
30 0.16
31 0.13
32 0.11
33 0.1
34 0.1
35 0.09
36 0.08
37 0.09
38 0.11
39 0.14
40 0.14
41 0.14
42 0.15
43 0.2
44 0.22
45 0.23
46 0.23
47 0.26
48 0.28
49 0.29
50 0.34
51 0.35
52 0.4
53 0.47
54 0.53
55 0.54
56 0.55
57 0.55
58 0.53
59 0.56
60 0.49
61 0.41
62 0.37
63 0.33
64 0.36
65 0.37
66 0.34
67 0.27
68 0.32
69 0.38
70 0.4
71 0.39
72 0.39
73 0.44
74 0.49
75 0.54
76 0.54
77 0.58
78 0.55
79 0.61
80 0.66
81 0.68
82 0.7
83 0.71
84 0.75
85 0.75
86 0.81
87 0.81