Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

S9XJA4

Protein Details
Accession S9XJA4   
Localization Confidence Medium
Confidence Score 14.3
NoLS Segment(s)
PositionSequenceProtein Nature
200-224QPSVSKPPKKAPPPAPPKPRRLISRHydrophilic
NLS Segment(s)
PositionSequence
205-220KPPKKAPPPAPPKPRR
Subcellular Location(s) nucl 23.5, cyto_nucl 14
Family & Domain DBs
Gene Ontology GO:0005737  C:cytoplasm  
Amino Acid Sequences MAFDAKKSFGSLQTSANRAQQKLNSKLPAEFARDGPMYDTRAVYGSGPRLSIRHVDVSTLPPPPKHFSQLHPNASSPSSSAKAAASPSKPSFLAQSPSLTSPSPPTSVLNSPSSPTRSTSRAPPPPPPVRSPLTSSTFAGEESSSLPPPPYTSASSIPPSSAPKAPPLPTPTKTNSPAPPPRRTLLTPGVNTIPPQPVPQPSVSKPPKKAPPPAPPKPRRLISRDSTPSAGAIPVPPPIQRNTRPSL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.4
2 0.4
3 0.44
4 0.45
5 0.41
6 0.44
7 0.43
8 0.48
9 0.52
10 0.57
11 0.56
12 0.53
13 0.53
14 0.53
15 0.51
16 0.48
17 0.42
18 0.35
19 0.35
20 0.33
21 0.32
22 0.29
23 0.28
24 0.24
25 0.23
26 0.22
27 0.17
28 0.18
29 0.18
30 0.16
31 0.17
32 0.19
33 0.18
34 0.19
35 0.19
36 0.19
37 0.2
38 0.23
39 0.22
40 0.23
41 0.22
42 0.23
43 0.24
44 0.27
45 0.28
46 0.3
47 0.28
48 0.24
49 0.28
50 0.31
51 0.32
52 0.34
53 0.34
54 0.34
55 0.44
56 0.52
57 0.54
58 0.51
59 0.49
60 0.45
61 0.42
62 0.38
63 0.27
64 0.22
65 0.17
66 0.15
67 0.15
68 0.13
69 0.14
70 0.16
71 0.2
72 0.18
73 0.22
74 0.23
75 0.24
76 0.24
77 0.23
78 0.24
79 0.21
80 0.23
81 0.19
82 0.2
83 0.19
84 0.2
85 0.21
86 0.18
87 0.16
88 0.16
89 0.17
90 0.16
91 0.15
92 0.15
93 0.17
94 0.19
95 0.22
96 0.21
97 0.2
98 0.19
99 0.21
100 0.22
101 0.2
102 0.2
103 0.2
104 0.2
105 0.21
106 0.28
107 0.34
108 0.4
109 0.41
110 0.45
111 0.51
112 0.55
113 0.56
114 0.51
115 0.47
116 0.42
117 0.42
118 0.4
119 0.37
120 0.34
121 0.32
122 0.3
123 0.26
124 0.24
125 0.22
126 0.18
127 0.12
128 0.08
129 0.09
130 0.1
131 0.09
132 0.09
133 0.09
134 0.09
135 0.1
136 0.12
137 0.13
138 0.14
139 0.16
140 0.18
141 0.21
142 0.24
143 0.23
144 0.21
145 0.2
146 0.21
147 0.21
148 0.22
149 0.2
150 0.23
151 0.27
152 0.28
153 0.31
154 0.35
155 0.38
156 0.38
157 0.43
158 0.42
159 0.44
160 0.47
161 0.48
162 0.46
163 0.49
164 0.56
165 0.57
166 0.59
167 0.57
168 0.55
169 0.54
170 0.51
171 0.49
172 0.48
173 0.49
174 0.43
175 0.42
176 0.42
177 0.38
178 0.37
179 0.33
180 0.27
181 0.2
182 0.22
183 0.22
184 0.23
185 0.26
186 0.3
187 0.33
188 0.32
189 0.42
190 0.49
191 0.54
192 0.56
193 0.62
194 0.67
195 0.68
196 0.76
197 0.75
198 0.77
199 0.78
200 0.83
201 0.85
202 0.84
203 0.85
204 0.84
205 0.82
206 0.79
207 0.76
208 0.74
209 0.7
210 0.73
211 0.71
212 0.66
213 0.6
214 0.53
215 0.47
216 0.39
217 0.32
218 0.22
219 0.17
220 0.14
221 0.16
222 0.17
223 0.18
224 0.2
225 0.25
226 0.33
227 0.38