Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

S9VV68

Protein Details
Accession S9VV68    Localization Confidence Low Confidence Score 8.3
NoLS Segment(s)
PositionSequenceProtein Nature
349-368APKKKTGKVVSKWKVNPQDTHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 12, mito 10, cyto_nucl 10, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR014752  Arrestin-like_C  
IPR011022  Arrestin_C-like  
IPR014756  Ig_E-set  
Pfam View protein in Pfam  
PF02752  Arrestin_C  
Amino Acid Sequences MKILKKLPLCFTNKSESVISEQESNSETCSLGSSKSLWGLSETETVTDGFYNGEKDTGFGKTKRFSSTIEWRDPFYTGQREKTLFPITKSPIRKSKPQLLDLSRNPFVDTENLKLAITLPEGPLHAGTFIKGHVWVSYEPLRNQDDSICLTQLYVDLFGTLKLKSAIEPIFSVSEKYSLQHALPATPTNLGAFSSNEFGFLLKEPCKFSFPFAFVVPLDLGPGSFRTQKLQFSYSFSATLFFSSLSGEAQFTRTSIEKTILPSMNENVASINNNIVCENTVYSKKLDTPKISLRISISRSLFFSGQDVGLNIQYNSKSQSIVRYINVCLLESIQVLKTDSSQYHASQAAPKKKTGKVVSKWKVNPQDTGYHIYPQLGKIYIFLNLPGSCRTIETNAQVRISYTIKVSLKTVLHSKLTEAYLPITILHAHK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.54
2 0.48
3 0.4
4 0.4
5 0.37
6 0.34
7 0.3
8 0.28
9 0.26
10 0.27
11 0.26
12 0.22
13 0.19
14 0.18
15 0.13
16 0.16
17 0.15
18 0.13
19 0.15
20 0.15
21 0.16
22 0.2
23 0.2
24 0.18
25 0.19
26 0.19
27 0.2
28 0.23
29 0.22
30 0.18
31 0.19
32 0.18
33 0.17
34 0.15
35 0.12
36 0.09
37 0.1
38 0.11
39 0.1
40 0.11
41 0.11
42 0.11
43 0.13
44 0.17
45 0.21
46 0.22
47 0.28
48 0.33
49 0.37
50 0.41
51 0.41
52 0.39
53 0.42
54 0.5
55 0.53
56 0.56
57 0.54
58 0.51
59 0.51
60 0.49
61 0.43
62 0.39
63 0.4
64 0.35
65 0.39
66 0.42
67 0.43
68 0.42
69 0.46
70 0.48
71 0.41
72 0.39
73 0.42
74 0.42
75 0.48
76 0.53
77 0.54
78 0.55
79 0.57
80 0.64
81 0.64
82 0.69
83 0.68
84 0.69
85 0.71
86 0.68
87 0.73
88 0.69
89 0.69
90 0.62
91 0.54
92 0.48
93 0.39
94 0.33
95 0.31
96 0.27
97 0.23
98 0.22
99 0.23
100 0.22
101 0.21
102 0.21
103 0.16
104 0.15
105 0.13
106 0.11
107 0.12
108 0.12
109 0.13
110 0.12
111 0.1
112 0.1
113 0.08
114 0.08
115 0.07
116 0.07
117 0.08
118 0.08
119 0.08
120 0.08
121 0.1
122 0.1
123 0.14
124 0.21
125 0.24
126 0.24
127 0.29
128 0.3
129 0.28
130 0.29
131 0.25
132 0.21
133 0.2
134 0.21
135 0.16
136 0.14
137 0.13
138 0.13
139 0.12
140 0.1
141 0.08
142 0.06
143 0.06
144 0.06
145 0.07
146 0.08
147 0.07
148 0.08
149 0.08
150 0.08
151 0.08
152 0.13
153 0.13
154 0.13
155 0.13
156 0.14
157 0.15
158 0.15
159 0.15
160 0.11
161 0.12
162 0.11
163 0.12
164 0.12
165 0.12
166 0.12
167 0.14
168 0.14
169 0.13
170 0.14
171 0.14
172 0.13
173 0.12
174 0.12
175 0.09
176 0.09
177 0.08
178 0.08
179 0.07
180 0.08
181 0.09
182 0.09
183 0.09
184 0.09
185 0.09
186 0.09
187 0.09
188 0.12
189 0.12
190 0.14
191 0.16
192 0.17
193 0.2
194 0.19
195 0.21
196 0.21
197 0.21
198 0.21
199 0.19
200 0.19
201 0.16
202 0.17
203 0.14
204 0.1
205 0.09
206 0.07
207 0.06
208 0.05
209 0.06
210 0.07
211 0.09
212 0.1
213 0.13
214 0.15
215 0.19
216 0.21
217 0.23
218 0.22
219 0.26
220 0.28
221 0.26
222 0.24
223 0.21
224 0.19
225 0.17
226 0.16
227 0.11
228 0.08
229 0.07
230 0.06
231 0.07
232 0.06
233 0.06
234 0.06
235 0.06
236 0.07
237 0.07
238 0.07
239 0.09
240 0.09
241 0.1
242 0.11
243 0.12
244 0.13
245 0.15
246 0.22
247 0.22
248 0.21
249 0.22
250 0.22
251 0.23
252 0.21
253 0.19
254 0.13
255 0.12
256 0.13
257 0.11
258 0.12
259 0.1
260 0.11
261 0.1
262 0.1
263 0.1
264 0.09
265 0.1
266 0.11
267 0.13
268 0.14
269 0.15
270 0.16
271 0.21
272 0.27
273 0.32
274 0.32
275 0.36
276 0.43
277 0.49
278 0.48
279 0.45
280 0.41
281 0.41
282 0.41
283 0.41
284 0.35
285 0.29
286 0.29
287 0.3
288 0.27
289 0.21
290 0.19
291 0.14
292 0.13
293 0.12
294 0.11
295 0.1
296 0.11
297 0.12
298 0.1
299 0.12
300 0.12
301 0.13
302 0.16
303 0.15
304 0.15
305 0.16
306 0.22
307 0.25
308 0.27
309 0.29
310 0.29
311 0.29
312 0.32
313 0.31
314 0.25
315 0.2
316 0.17
317 0.15
318 0.13
319 0.14
320 0.11
321 0.11
322 0.12
323 0.12
324 0.13
325 0.15
326 0.15
327 0.18
328 0.2
329 0.19
330 0.22
331 0.24
332 0.23
333 0.27
334 0.36
335 0.42
336 0.41
337 0.45
338 0.48
339 0.51
340 0.59
341 0.6
342 0.62
343 0.62
344 0.71
345 0.75
346 0.78
347 0.79
348 0.79
349 0.8
350 0.73
351 0.69
352 0.61
353 0.59
354 0.53
355 0.55
356 0.47
357 0.4
358 0.38
359 0.35
360 0.33
361 0.28
362 0.28
363 0.22
364 0.21
365 0.18
366 0.19
367 0.19
368 0.17
369 0.16
370 0.17
371 0.17
372 0.19
373 0.19
374 0.2
375 0.18
376 0.19
377 0.21
378 0.21
379 0.25
380 0.3
381 0.36
382 0.38
383 0.39
384 0.38
385 0.36
386 0.36
387 0.33
388 0.27
389 0.21
390 0.25
391 0.26
392 0.27
393 0.28
394 0.3
395 0.3
396 0.33
397 0.38
398 0.35
399 0.37
400 0.37
401 0.37
402 0.37
403 0.37
404 0.35
405 0.29
406 0.26
407 0.23
408 0.23
409 0.21
410 0.16