Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

S9XAT1

Protein Details
Accession S9XAT1    Localization Confidence Medium Confidence Score 12.3
NoLS Segment(s)
PositionSequenceProtein Nature
96-121TFERDTSKAKHKRSRALLLKDKRARYHydrophilic
NLS Segment(s)
PositionSequence
103-120KAKHKRSRALLLKDKRAR
Subcellular Location(s) nucl 16.5, cyto_nucl 12, cyto 6.5, mito 3
Family & Domain DBs
Amino Acid Sequences MEDFELIRKNEADPYYFNPCLKFEEHIVDGFLSICKAPPPFSFVASQARNKQSVGAVTTERFPALTNERFFGNKKTPGVSDSQVFCSIEPQELPFTFERDTSKAKHKRSRALLLKDKRARY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.29
2 0.35
3 0.37
4 0.37
5 0.32
6 0.32
7 0.33
8 0.31
9 0.28
10 0.22
11 0.25
12 0.25
13 0.24
14 0.23
15 0.19
16 0.18
17 0.15
18 0.13
19 0.08
20 0.07
21 0.07
22 0.08
23 0.09
24 0.11
25 0.11
26 0.16
27 0.17
28 0.19
29 0.2
30 0.2
31 0.27
32 0.28
33 0.32
34 0.33
35 0.35
36 0.34
37 0.33
38 0.31
39 0.25
40 0.23
41 0.2
42 0.15
43 0.14
44 0.13
45 0.14
46 0.13
47 0.11
48 0.1
49 0.09
50 0.1
51 0.14
52 0.18
53 0.18
54 0.19
55 0.2
56 0.21
57 0.22
58 0.25
59 0.26
60 0.26
61 0.26
62 0.27
63 0.27
64 0.27
65 0.3
66 0.26
67 0.24
68 0.22
69 0.23
70 0.24
71 0.23
72 0.21
73 0.2
74 0.19
75 0.16
76 0.15
77 0.13
78 0.15
79 0.15
80 0.19
81 0.17
82 0.19
83 0.18
84 0.2
85 0.22
86 0.22
87 0.26
88 0.27
89 0.37
90 0.43
91 0.52
92 0.59
93 0.64
94 0.7
95 0.75
96 0.82
97 0.81
98 0.83
99 0.84
100 0.84
101 0.86