Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

S9X9Y4

Protein Details
Accession S9X9Y4   
Localization Confidence High
Confidence Score 16.5
NoLS Segment(s)
PositionSequenceProtein Nature
89-108MNDYQKEIIKSRKKRKENSPHydrophilic
NLS Segment(s)
PositionSequence
98-105KSRKKRKE
Subcellular Location(s) nucl 23, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR029003  CENP-S/Mhf1  
IPR009072  Histone-fold  
Gene Ontology GO:0071821  C:FANCM-MHF complex  
GO:0046982  F:protein heterodimerization activity  
GO:0006281  P:DNA repair  
Pfam View protein in Pfam  
PF15630  CENP-S  
Amino Acid Sequences MEEERFKAEIFHVTQQVCNNTAAELRDSESRNVIVDELFCVGVTEMVWEQIRVLAKDVEDFAEHAGRKTIQPQDVVLCCRRNEGLHEMMNDYQKEIIKSRKKRKENSP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.33
2 0.36
3 0.37
4 0.32
5 0.29
6 0.24
7 0.19
8 0.21
9 0.19
10 0.16
11 0.14
12 0.14
13 0.19
14 0.21
15 0.21
16 0.21
17 0.2
18 0.19
19 0.18
20 0.17
21 0.11
22 0.1
23 0.09
24 0.08
25 0.08
26 0.07
27 0.06
28 0.06
29 0.06
30 0.05
31 0.06
32 0.05
33 0.06
34 0.07
35 0.06
36 0.06
37 0.08
38 0.09
39 0.08
40 0.1
41 0.09
42 0.09
43 0.1
44 0.1
45 0.09
46 0.08
47 0.08
48 0.07
49 0.11
50 0.11
51 0.1
52 0.12
53 0.12
54 0.12
55 0.17
56 0.22
57 0.2
58 0.21
59 0.22
60 0.25
61 0.28
62 0.31
63 0.31
64 0.29
65 0.27
66 0.28
67 0.29
68 0.25
69 0.26
70 0.28
71 0.3
72 0.29
73 0.31
74 0.31
75 0.33
76 0.36
77 0.31
78 0.27
79 0.24
80 0.23
81 0.24
82 0.27
83 0.34
84 0.4
85 0.5
86 0.61
87 0.68
88 0.76