Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

S9VTU7

Protein Details
Accession S9VTU7    Localization Confidence Low Confidence Score 7.7
NoLS Segment(s)
PositionSequenceProtein Nature
1-23MNPTLKKPKKNRNSNHNYKNGFIHydrophilic
NLS Segment(s)
Subcellular Location(s) mito_nucl 13.166, nucl 12.5, mito 12.5, cyto_nucl 8.333
Family & Domain DBs
InterPro View protein in InterPro  
IPR036910  HMG_box_dom_sf  
Gene Ontology GO:0003713  F:transcription coactivator activity  
GO:0010514  P:induction of conjugation with cellular fusion  
GO:1900237  P:positive regulation of induction of conjugation with cellular fusion  
GO:0051446  P:positive regulation of meiotic cell cycle  
GO:0045944  P:positive regulation of transcription by RNA polymerase II  
Amino Acid Sequences MNPTLKKPKKNRNSNHNYKNGFILFRSRIHKLLKSSGDWGGVSAKCSNIWRSLPQNVKSAWSQTAELSQYQDVRKQIATLEKIILTLWHKEHNNYKLHISTVQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.92
2 0.92
3 0.9
4 0.82
5 0.73
6 0.68
7 0.59
8 0.5
9 0.4
10 0.37
11 0.3
12 0.33
13 0.36
14 0.33
15 0.35
16 0.38
17 0.42
18 0.38
19 0.43
20 0.41
21 0.39
22 0.39
23 0.35
24 0.33
25 0.28
26 0.24
27 0.21
28 0.17
29 0.17
30 0.15
31 0.13
32 0.13
33 0.15
34 0.16
35 0.15
36 0.16
37 0.18
38 0.21
39 0.28
40 0.33
41 0.34
42 0.36
43 0.33
44 0.34
45 0.31
46 0.3
47 0.25
48 0.2
49 0.18
50 0.15
51 0.18
52 0.16
53 0.16
54 0.16
55 0.15
56 0.17
57 0.18
58 0.21
59 0.19
60 0.2
61 0.2
62 0.18
63 0.2
64 0.24
65 0.25
66 0.23
67 0.24
68 0.22
69 0.22
70 0.22
71 0.22
72 0.17
73 0.19
74 0.19
75 0.25
76 0.27
77 0.32
78 0.41
79 0.45
80 0.48
81 0.46
82 0.49
83 0.45