FuNGI

S9VSM9

Protein Details

Accession

S9VSM9

Localization Confidence

Medium

Confidence Score

NoLS Segment(s)

Position	Sequence	Protein Nature
464-490	LERNRQAALKCRQRKKQWLSNLQAKVE	Hydrophilic

NLS Segment(s)

Subcellular Location(s)

nucl 23, cyto_nucl 15.5

Family & Domain DBs

InterPro	View protein in InterPro IPR004827 bZIP IPR046347 bZIP_sf
Gene Ontology	GO:1990243 C:atf1-pcr1 complex GO:0000792 C:heterochromatin GO:0001228 F:DNA-binding transcription activator activity, RNA polymerase II-specific GO:0010844 F:recombination hotspot binding GO:0003723 F:RNA binding GO:0000978 F:RNA polymerase II cis-regulatory region sequence-specific DNA binding GO:0010846 P:activation of reciprocal meiotic recombination GO:0006325 P:chromatin organization GO:0110034 P:negative regulation of adenylate cyclase-activating glucose-activated G protein-coupled receptor signaling pathway GO:0060195 P:negative regulation of antisense RNA transcription GO:0045128 P:negative regulation of reciprocal meiotic recombination GO:0000122 P:negative regulation of transcription by RNA polymerase II GO:0007131 P:reciprocal meiotic recombination
Pfam	View protein in Pfam PF00170 bZIP_1
PROSITE	View protein in PROSITE PS50217 BZIP
CDD	cd14687 bZIP_ATF2

Amino Acid Sequences

MSPSPNNASNNYNPSEAPPNPNSTSAVNNNPSVDNNINVPSTQQSQQPPPNNVNGGADPLEQPAGVTPSFVGSLKLDFEPNPFEHSFGSTATVNQQQPGPSTSRPAPSAIPPSFSRTLLPPVSSIASPDILGAPGVASPLAYPAWSGFTRGGMQNPLSPAIYDATLRPDYLNTPSDPSMAMGSRFSFGTGFTPGGNDSFRSLLTPTGASFPAPSPGTANLLGFQPFDSQYPDQYRFTPRDGKPPVSAGTNGEQSDYFGANAAVHGLCLLSQVPEQQKMQPSVPNETDPSTSAAVANLLKQSQSQQYPDSIRPSFTHNANNSLEAQNMGQSPYYMNANQLRGDMQPSVYGETVNPADPSLNLRPSNNYGMNMNNMSHIGQGGNREMPSNGMPVQVKSEVNERQDSQPRAMSGHSNVSPSASPSEADMKDLDSTDFNGESNNSKSGSTPRRNSKNETDDEKRKSFLERNRQAALKCRQRKKQWLSNLQAKVEFYGNENEILSAQVSALREEIVSLKTLLIAHKDCPVAKGNSAAVATTIIGNGDMSQRINLGY

FASTA Sequence
with NoLS information

AlphaFold Structure
with highlighted NoLS

NoLS Predictions per Residue

Residue Number	Score
1	0.38
2	0.43
3	0.4
4	0.41
5	0.39
6	0.43
7	0.43
8	0.45
9	0.43
10	0.37
11	0.41
12	0.39
13	0.43
14	0.4
15	0.4
16	0.4
17	0.39
18	0.38
19	0.37
20	0.33
21	0.26
22	0.25
23	0.26
24	0.24
25	0.23
26	0.23
27	0.2
28	0.23
29	0.24
30	0.27
31	0.3
32	0.39
33	0.48
34	0.54
35	0.57
36	0.57
37	0.61
38	0.57
39	0.53
40	0.47
41	0.39
42	0.34
43	0.3
44	0.26
45	0.21
46	0.19
47	0.18
48	0.14
49	0.14
50	0.12
51	0.13
52	0.11
53	0.11
54	0.1
55	0.1
56	0.12
57	0.12
58	0.12
59	0.1
60	0.12
61	0.14
62	0.15
63	0.16
64	0.15
65	0.18
66	0.22
67	0.22
68	0.27
69	0.24
70	0.24
71	0.23
72	0.25
73	0.23
74	0.18
75	0.2
76	0.15
77	0.15
78	0.18
79	0.24
80	0.22
81	0.23
82	0.25
83	0.23
84	0.25
85	0.27
86	0.27
87	0.22
88	0.27
89	0.3
90	0.32
91	0.32
92	0.32
93	0.31
94	0.32
95	0.4
96	0.35
97	0.35
98	0.32
99	0.38
100	0.38
101	0.36
102	0.32
103	0.26
104	0.31
105	0.29
106	0.29
107	0.22
108	0.22
109	0.23
110	0.22
111	0.2
112	0.15
113	0.14
114	0.13
115	0.13
116	0.11
117	0.09
118	0.09
119	0.07
120	0.06
121	0.05
122	0.05
123	0.04
124	0.04
125	0.04
126	0.05
127	0.05
128	0.05
129	0.05
130	0.06
131	0.1
132	0.1
133	0.12
134	0.11
135	0.13
136	0.16
137	0.17
138	0.19
139	0.17
140	0.18
141	0.19
142	0.2
143	0.2
144	0.18
145	0.16
146	0.15
147	0.13
148	0.13
149	0.1
150	0.1
151	0.14
152	0.14
153	0.15
154	0.14
155	0.14
156	0.15
157	0.18
158	0.2
159	0.16
160	0.19
161	0.19
162	0.19
163	0.18
164	0.17
165	0.15
166	0.14
167	0.13
168	0.11
169	0.11
170	0.11
171	0.11
172	0.11
173	0.09
174	0.08
175	0.09
176	0.1
177	0.1
178	0.09
179	0.1
180	0.1
181	0.11
182	0.11
183	0.09
184	0.09
185	0.09
186	0.09
187	0.09
188	0.1
189	0.09
190	0.1
191	0.1
192	0.09
193	0.11
194	0.11
195	0.1
196	0.11
197	0.1
198	0.13
199	0.13
200	0.13
201	0.12
202	0.13
203	0.15
204	0.15
205	0.15
206	0.11
207	0.12
208	0.12
209	0.11
210	0.1
211	0.09
212	0.09
213	0.1
214	0.13
215	0.12
216	0.16
217	0.21
218	0.24
219	0.24
220	0.26
221	0.29
222	0.28
223	0.32
224	0.37
225	0.33
226	0.4
227	0.43
228	0.43
229	0.4
230	0.4
231	0.37
232	0.29
233	0.29
234	0.21
235	0.2
236	0.2
237	0.18
238	0.16
239	0.15
240	0.14
241	0.14
242	0.12
243	0.09
244	0.07
245	0.07
246	0.06
247	0.06
248	0.07
249	0.05
250	0.04
251	0.04
252	0.04
253	0.03
254	0.04
255	0.04
256	0.04
257	0.04
258	0.08
259	0.1
260	0.12
261	0.13
262	0.16
263	0.2
264	0.21
265	0.23
266	0.22
267	0.23
268	0.25
269	0.26
270	0.24
271	0.21
272	0.21
273	0.2
274	0.18
275	0.18
276	0.14
277	0.13
278	0.11
279	0.1
280	0.1
281	0.09
282	0.1
283	0.08
284	0.08
285	0.08
286	0.08
287	0.1
288	0.14
289	0.16
290	0.17
291	0.17
292	0.21
293	0.25
294	0.27
295	0.3
296	0.25
297	0.25
298	0.24
299	0.29
300	0.28
301	0.27
302	0.32
303	0.28
304	0.33
305	0.32
306	0.33
307	0.29
308	0.26
309	0.24
310	0.17
311	0.16
312	0.12
313	0.12
314	0.11
315	0.08
316	0.08
317	0.08
318	0.08
319	0.11
320	0.09
321	0.12
322	0.15
323	0.17
324	0.17
325	0.17
326	0.17
327	0.16
328	0.18
329	0.15
330	0.11
331	0.11
332	0.11
333	0.13
334	0.12
335	0.11
336	0.09
337	0.11
338	0.12
339	0.11
340	0.1
341	0.08
342	0.09
343	0.09
344	0.14
345	0.16
346	0.2
347	0.2
348	0.21
349	0.25
350	0.28
351	0.34
352	0.3
353	0.27
354	0.24
355	0.24
356	0.26
357	0.24
358	0.21
359	0.15
360	0.14
361	0.14
362	0.12
363	0.11
364	0.08
365	0.08
366	0.1
367	0.12
368	0.13
369	0.13
370	0.14
371	0.13
372	0.15
373	0.15
374	0.15
375	0.13
376	0.15
377	0.16
378	0.15
379	0.19
380	0.2
381	0.19
382	0.18
383	0.24
384	0.25
385	0.28
386	0.31
387	0.3
388	0.34
389	0.42
390	0.44
391	0.4
392	0.38
393	0.35
394	0.33
395	0.32
396	0.28
397	0.23
398	0.27
399	0.26
400	0.24
401	0.23
402	0.24
403	0.23
404	0.21
405	0.2
406	0.14
407	0.12
408	0.13
409	0.21
410	0.19
411	0.2
412	0.18
413	0.18
414	0.18
415	0.19
416	0.18
417	0.11
418	0.13
419	0.14
420	0.14
421	0.12
422	0.12
423	0.13
424	0.15
425	0.17
426	0.18
427	0.16
428	0.16
429	0.18
430	0.27
431	0.36
432	0.41
433	0.48
434	0.56
435	0.65
436	0.7
437	0.76
438	0.77
439	0.76
440	0.74
441	0.73
442	0.72
443	0.71
444	0.74
445	0.69
446	0.6
447	0.52
448	0.52
449	0.52
450	0.52
451	0.54
452	0.55
453	0.59
454	0.62
455	0.65
456	0.6
457	0.62
458	0.62
459	0.62
460	0.64
461	0.67
462	0.72
463	0.78
464	0.87
465	0.87
466	0.87
467	0.87
468	0.87
469	0.87
470	0.87
471	0.83
472	0.75
473	0.68
474	0.59
475	0.5
476	0.42
477	0.33
478	0.26
479	0.26
480	0.23
481	0.22
482	0.21
483	0.19
484	0.17
485	0.17
486	0.15
487	0.09
488	0.08
489	0.1
490	0.1
491	0.1
492	0.11
493	0.1
494	0.1
495	0.1
496	0.13
497	0.11
498	0.12
499	0.12
500	0.12
501	0.13
502	0.15
503	0.16
504	0.2
505	0.21
506	0.21
507	0.26
508	0.3
509	0.29
510	0.3
511	0.35
512	0.31
513	0.31
514	0.34
515	0.3
516	0.3
517	0.3
518	0.27
519	0.21
520	0.18
521	0.17
522	0.13
523	0.12
524	0.08
525	0.08
526	0.08
527	0.08
528	0.1
529	0.12
530	0.12
531	0.13

S9VSM9

3D AlphaFold-predicted Structure Viewer