Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

S9X493

Protein Details
Accession S9X493    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
96-128WEAGREKRAGIRREKKKQKKEERKRKIDAGEKVBasic
NLS Segment(s)
PositionSequence
80-139PKMSKSALKKLRRQQEWEAGREKRAGIRREKKKQKKEERKRKIDAGEKVPSQKKKIREGK
Subcellular Location(s) mito 8, plas 5, mito_nucl 5, golg 4, E.R. 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR028564  MT_TRM10-typ  
IPR038459  MT_TRM10-typ_sf  
IPR007356  tRNA_m1G_MeTrfase_euk  
IPR016009  tRNA_MeTrfase_TRMD/TRM10  
Gene Ontology GO:0052905  F:tRNA (guanine(9)-N(1))-methyltransferase activity  
GO:0002939  P:tRNA N1-guanine methylation  
Pfam View protein in Pfam  
PF01746  tRNA_m1G_MT  
PROSITE View protein in PROSITE  
PS51675  SAM_MT_TRM10  
CDD cd18089  SPOUT_Trm10-like  
Amino Acid Sequences MCGRFTFEVCVGILSFLVLAKPSSTVFFEFLGSFRAFVSIPGNEMSGSVNFPNAANALAGSTTNSDKEPVLERREEAEPPKMSKSALKKLRRQQEWEAGREKRAGIRREKKKQKKEERKRKIDAGEKVPSQKKKIREGKITPSEMRVVLDCGFDELMNEKEIASLCQQFTRCHSANRTALHPVELYATDFGGRLEARQEYVLRGQQKNWKRYHPTTNSYLEEFVNEKEKMVYLSADSDETLHELKEDEIYIIGALVDKNRYKNICDEKAKSQGIRTAKLPIGEYIRMSDRKVLTVNHVFEILSLWLEHRDWEKAFLEVIPKRKGLASLDEEESREQSLEQESVSEKAEEAEDEAKTADGVEMPAEKRIKITE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.1
2 0.09
3 0.07
4 0.07
5 0.07
6 0.07
7 0.07
8 0.09
9 0.09
10 0.11
11 0.14
12 0.15
13 0.17
14 0.17
15 0.18
16 0.17
17 0.17
18 0.19
19 0.17
20 0.15
21 0.13
22 0.14
23 0.12
24 0.13
25 0.17
26 0.13
27 0.14
28 0.15
29 0.15
30 0.13
31 0.14
32 0.14
33 0.11
34 0.13
35 0.11
36 0.12
37 0.12
38 0.12
39 0.13
40 0.11
41 0.1
42 0.08
43 0.08
44 0.08
45 0.07
46 0.07
47 0.07
48 0.09
49 0.1
50 0.11
51 0.11
52 0.12
53 0.12
54 0.15
55 0.21
56 0.25
57 0.3
58 0.31
59 0.32
60 0.34
61 0.37
62 0.38
63 0.34
64 0.36
65 0.35
66 0.36
67 0.38
68 0.35
69 0.33
70 0.36
71 0.41
72 0.42
73 0.48
74 0.54
75 0.6
76 0.68
77 0.77
78 0.77
79 0.75
80 0.73
81 0.74
82 0.71
83 0.68
84 0.66
85 0.59
86 0.55
87 0.5
88 0.43
89 0.39
90 0.41
91 0.42
92 0.45
93 0.53
94 0.61
95 0.7
96 0.8
97 0.85
98 0.87
99 0.92
100 0.92
101 0.94
102 0.95
103 0.95
104 0.95
105 0.95
106 0.91
107 0.87
108 0.84
109 0.81
110 0.77
111 0.73
112 0.68
113 0.61
114 0.62
115 0.61
116 0.57
117 0.54
118 0.52
119 0.51
120 0.56
121 0.63
122 0.63
123 0.66
124 0.68
125 0.72
126 0.75
127 0.73
128 0.64
129 0.56
130 0.5
131 0.4
132 0.34
133 0.24
134 0.18
135 0.13
136 0.13
137 0.1
138 0.09
139 0.09
140 0.08
141 0.08
142 0.08
143 0.08
144 0.08
145 0.08
146 0.07
147 0.08
148 0.08
149 0.09
150 0.1
151 0.12
152 0.11
153 0.15
154 0.16
155 0.16
156 0.19
157 0.26
158 0.25
159 0.26
160 0.28
161 0.32
162 0.35
163 0.36
164 0.34
165 0.3
166 0.29
167 0.27
168 0.24
169 0.17
170 0.14
171 0.12
172 0.11
173 0.08
174 0.07
175 0.06
176 0.06
177 0.06
178 0.06
179 0.06
180 0.05
181 0.07
182 0.07
183 0.08
184 0.09
185 0.09
186 0.1
187 0.13
188 0.16
189 0.2
190 0.21
191 0.24
192 0.32
193 0.39
194 0.46
195 0.47
196 0.51
197 0.53
198 0.59
199 0.65
200 0.65
201 0.62
202 0.59
203 0.61
204 0.55
205 0.48
206 0.43
207 0.33
208 0.26
209 0.23
210 0.18
211 0.18
212 0.16
213 0.15
214 0.14
215 0.14
216 0.13
217 0.13
218 0.12
219 0.07
220 0.09
221 0.09
222 0.09
223 0.09
224 0.09
225 0.08
226 0.09
227 0.09
228 0.07
229 0.07
230 0.07
231 0.07
232 0.08
233 0.08
234 0.07
235 0.06
236 0.07
237 0.06
238 0.06
239 0.05
240 0.05
241 0.05
242 0.06
243 0.1
244 0.12
245 0.14
246 0.19
247 0.2
248 0.22
249 0.3
250 0.38
251 0.43
252 0.48
253 0.51
254 0.52
255 0.6
256 0.61
257 0.53
258 0.47
259 0.44
260 0.42
261 0.4
262 0.35
263 0.33
264 0.31
265 0.32
266 0.31
267 0.28
268 0.28
269 0.26
270 0.25
271 0.22
272 0.26
273 0.26
274 0.26
275 0.29
276 0.25
277 0.27
278 0.29
279 0.28
280 0.3
281 0.36
282 0.37
283 0.31
284 0.3
285 0.27
286 0.25
287 0.25
288 0.18
289 0.11
290 0.09
291 0.09
292 0.1
293 0.1
294 0.13
295 0.13
296 0.17
297 0.17
298 0.21
299 0.21
300 0.2
301 0.21
302 0.2
303 0.26
304 0.27
305 0.34
306 0.34
307 0.33
308 0.34
309 0.34
310 0.36
311 0.31
312 0.34
313 0.33
314 0.33
315 0.37
316 0.38
317 0.37
318 0.36
319 0.33
320 0.26
321 0.21
322 0.16
323 0.15
324 0.16
325 0.15
326 0.14
327 0.15
328 0.15
329 0.17
330 0.19
331 0.17
332 0.13
333 0.14
334 0.15
335 0.13
336 0.14
337 0.16
338 0.14
339 0.15
340 0.15
341 0.14
342 0.13
343 0.13
344 0.1
345 0.08
346 0.08
347 0.09
348 0.14
349 0.15
350 0.22
351 0.23
352 0.22