Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

S9WWT3

Protein Details
Accession S9WWT3    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
74-96LVRRKGRLYILCKKHPRHKTRQGBasic
NLS Segment(s)
Subcellular Location(s) mito 23.5, mito_nucl 13.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR000473  Ribosomal_L36  
IPR035977  Ribosomal_L36_sp  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00444  Ribosomal_L36  
Amino Acid Sequences MSFLSRFAWRAWKPQFIPMLGAMRFHWNRNLPMNHVHMLSSSPFASLNSRLPLIPSQGFKTKASVKKRCSSCYLVRRKGRLYILCKKHPRHKTRQG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.52
2 0.55
3 0.46
4 0.46
5 0.4
6 0.4
7 0.31
8 0.3
9 0.24
10 0.29
11 0.29
12 0.28
13 0.31
14 0.28
15 0.32
16 0.39
17 0.4
18 0.34
19 0.38
20 0.4
21 0.35
22 0.32
23 0.28
24 0.2
25 0.2
26 0.17
27 0.14
28 0.1
29 0.08
30 0.08
31 0.09
32 0.1
33 0.11
34 0.13
35 0.12
36 0.13
37 0.12
38 0.13
39 0.14
40 0.15
41 0.16
42 0.15
43 0.17
44 0.22
45 0.25
46 0.24
47 0.27
48 0.32
49 0.38
50 0.46
51 0.52
52 0.54
53 0.6
54 0.65
55 0.65
56 0.63
57 0.62
58 0.62
59 0.63
60 0.68
61 0.69
62 0.71
63 0.73
64 0.7
65 0.7
66 0.68
67 0.67
68 0.64
69 0.65
70 0.67
71 0.71
72 0.77
73 0.78
74 0.8
75 0.82
76 0.84