Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

S9W173

Protein Details
Accession S9W173    Localization Confidence Low Confidence Score 7.3
NoLS Segment(s)
PositionSequenceProtein Nature
1-24MNQYRLRECFKKKKLSFSRCWRLVHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 15, nucl 6, cyto 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR042098  TauD-like_sf  
IPR003819  TauD/TfdA-like  
Gene Ontology GO:0016491  F:oxidoreductase activity  
Pfam View protein in Pfam  
PF02668  TauD  
Amino Acid Sequences MNQYRLRECFKKKKLSFSRCWRLVLHGLRLNRLNEAQRDELARLIAERGVVYFPGQKEMTNDEFQQLGRYYGKTHVHGANARPNDPSKSDFHVVYSDRYTAFDIEDNRTDLERFHSDVSYEKQPLATTFFRGLTVPKYGGDTVIVSGYVAY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.83
2 0.84
3 0.84
4 0.84
5 0.86
6 0.79
7 0.78
8 0.68
9 0.62
10 0.62
11 0.57
12 0.54
13 0.48
14 0.45
15 0.46
16 0.49
17 0.44
18 0.38
19 0.36
20 0.32
21 0.3
22 0.34
23 0.32
24 0.29
25 0.3
26 0.28
27 0.25
28 0.21
29 0.17
30 0.12
31 0.11
32 0.1
33 0.08
34 0.08
35 0.07
36 0.07
37 0.07
38 0.08
39 0.11
40 0.1
41 0.14
42 0.15
43 0.14
44 0.16
45 0.21
46 0.24
47 0.22
48 0.22
49 0.19
50 0.19
51 0.19
52 0.2
53 0.15
54 0.13
55 0.12
56 0.12
57 0.13
58 0.18
59 0.21
60 0.2
61 0.23
62 0.22
63 0.24
64 0.26
65 0.28
66 0.29
67 0.27
68 0.26
69 0.24
70 0.24
71 0.23
72 0.23
73 0.23
74 0.19
75 0.23
76 0.24
77 0.23
78 0.22
79 0.25
80 0.24
81 0.24
82 0.22
83 0.18
84 0.16
85 0.17
86 0.17
87 0.13
88 0.13
89 0.14
90 0.15
91 0.17
92 0.19
93 0.19
94 0.19
95 0.19
96 0.18
97 0.16
98 0.19
99 0.18
100 0.18
101 0.18
102 0.18
103 0.18
104 0.22
105 0.26
106 0.27
107 0.26
108 0.24
109 0.23
110 0.24
111 0.25
112 0.27
113 0.23
114 0.2
115 0.22
116 0.23
117 0.22
118 0.22
119 0.23
120 0.2
121 0.23
122 0.21
123 0.19
124 0.22
125 0.21
126 0.21
127 0.2
128 0.18
129 0.15
130 0.14
131 0.13