Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

S9XC65

Protein Details
Accession S9XC65    Localization Confidence Low Confidence Score 8.9
NoLS Segment(s)
PositionSequenceProtein Nature
177-202RAAMLKHKPKTKPSGGSKKKKRCILMBasic
NLS Segment(s)
PositionSequence
182-198KHKPKTKPSGGSKKKKR
Subcellular Location(s) cyto 12.5, cyto_mito 11.166, cyto_nucl 9.499, mito 7.5, mito_nucl 6.999, nucl 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR027417  P-loop_NTPase  
IPR005225  Small_GTP-bd_dom  
IPR001806  Small_GTPase  
IPR003578  Small_GTPase_Rho  
Gene Ontology GO:1902716  C:cell cortex of growing cell tip  
GO:0000935  C:division septum  
GO:0031097  C:medial cortex  
GO:0140453  C:protein aggregate center  
GO:0005525  F:GTP binding  
GO:0003924  F:GTPase activity  
GO:0035591  F:signaling adaptor activity  
GO:1905758  P:positive regulation of primary cell septum biogenesis  
GO:0140748  P:positive regulation of regulation of ascospore wall (1->3)-beta-D-glucan biosynthetic process  
GO:0032956  P:regulation of actin cytoskeleton organization  
GO:2000769  P:regulation of establishment or maintenance of cell polarity regulating cell shape  
GO:0070610  P:regulation of fungal-type cell wall (1->3)-alpha-glucan biosynthetic process  
GO:1903471  P:regulation of mitotic actomyosin contractile ring contraction  
GO:0007264  P:small GTPase mediated signal transduction  
Pfam View protein in Pfam  
PF00071  Ras  
PROSITE View protein in PROSITE  
PS51419  RAB  
PS51421  RAS  
PS51420  RHO  
CDD cd01870  RhoA_like  
Amino Acid Sequences MATELRRKLVIVGDGACGKTCLLIVFSKGTFPEVYVPTVFENYVADVDVDGRHVELALWDTAGQEDYDRLRPLSYPDSHVILICFAVDSPDSLDNVQEKWISEVLHFCSSLPILLVACKADLRNDPKIIEELSKTQQHPVSSEEGQAVAQKIGAYKYLECSAKTNQGVREVFESATRAAMLKHKPKTKPSGGSKKKKRCILM
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.26
2 0.26
3 0.24
4 0.19
5 0.16
6 0.13
7 0.12
8 0.09
9 0.09
10 0.1
11 0.12
12 0.15
13 0.16
14 0.17
15 0.17
16 0.18
17 0.16
18 0.16
19 0.2
20 0.18
21 0.2
22 0.18
23 0.2
24 0.19
25 0.2
26 0.18
27 0.13
28 0.12
29 0.1
30 0.1
31 0.09
32 0.08
33 0.06
34 0.08
35 0.07
36 0.08
37 0.07
38 0.06
39 0.06
40 0.06
41 0.06
42 0.05
43 0.07
44 0.07
45 0.07
46 0.07
47 0.07
48 0.07
49 0.08
50 0.07
51 0.05
52 0.07
53 0.09
54 0.12
55 0.13
56 0.13
57 0.13
58 0.14
59 0.17
60 0.22
61 0.21
62 0.22
63 0.23
64 0.25
65 0.25
66 0.24
67 0.21
68 0.14
69 0.13
70 0.08
71 0.07
72 0.04
73 0.04
74 0.04
75 0.04
76 0.06
77 0.07
78 0.07
79 0.07
80 0.08
81 0.08
82 0.09
83 0.1
84 0.09
85 0.08
86 0.09
87 0.11
88 0.1
89 0.09
90 0.11
91 0.13
92 0.14
93 0.14
94 0.12
95 0.12
96 0.11
97 0.11
98 0.09
99 0.06
100 0.05
101 0.05
102 0.06
103 0.05
104 0.05
105 0.06
106 0.06
107 0.08
108 0.13
109 0.18
110 0.22
111 0.24
112 0.24
113 0.24
114 0.26
115 0.25
116 0.21
117 0.18
118 0.17
119 0.2
120 0.25
121 0.25
122 0.27
123 0.29
124 0.28
125 0.28
126 0.26
127 0.27
128 0.22
129 0.23
130 0.19
131 0.17
132 0.16
133 0.17
134 0.15
135 0.1
136 0.1
137 0.09
138 0.1
139 0.1
140 0.12
141 0.12
142 0.12
143 0.15
144 0.2
145 0.22
146 0.22
147 0.25
148 0.26
149 0.33
150 0.35
151 0.37
152 0.34
153 0.41
154 0.4
155 0.38
156 0.37
157 0.31
158 0.28
159 0.25
160 0.25
161 0.17
162 0.17
163 0.15
164 0.12
165 0.12
166 0.19
167 0.26
168 0.33
169 0.42
170 0.49
171 0.55
172 0.64
173 0.72
174 0.74
175 0.75
176 0.77
177 0.8
178 0.83
179 0.88
180 0.9
181 0.92
182 0.92