Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

S9W466

Protein Details
Accession S9W466    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
5-26CLKSRYACKVIQKPYKNLKTLRHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 25, cyto 1.5, cyto_nucl 1.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR045462  aa-tRNA-synth_I_cd-bd  
IPR020751  aa-tRNA-synth_I_codon-bd_sub2  
IPR008925  aa_tRNA-synth_I_cd-bd_sf  
IPR004527  Glu-tRNA-ligase_bac/mito  
IPR000924  Glu/Gln-tRNA-synth  
IPR020058  Glu/Gln-tRNA-synth_Ib_cat-dom  
IPR033910  GluRS_core  
IPR014729  Rossmann-like_a/b/a_fold  
Gene Ontology GO:0005739  C:mitochondrion  
GO:0005524  F:ATP binding  
GO:0004818  F:glutamate-tRNA ligase activity  
GO:0000049  F:tRNA binding  
GO:0008270  F:zinc ion binding  
GO:0006424  P:glutamyl-tRNA aminoacylation  
GO:0032543  P:mitochondrial translation  
Pfam View protein in Pfam  
PF19269  Anticodon_2  
PF00749  tRNA-synt_1c  
CDD cd00808  GluRS_core  
Amino Acid Sequences MLSFCLKSRYACKVIQKPYKNLKTLRWNSTTVRTRFAPSPTGFLHLGSLRTALFNYLWAKKCNGKFIVRLEDTDQKRKVNGSEQSIYDLLQTFGLQWDEGPITGGPFGPYEQSKRLHIYSEYISKLLASGKAYKCYDECSTQSPKTDKNPYVVRFRSEEGPITFVDTVYGKITIKRNTPKVLSDDFVLLKSDGYPTYHFANVVDDHLMGITNVIRGEEWIPSTPKHIQLYKAFHWRPPTYSHIPLLTNPDGSKLSKRQNDAHVTSLLEKGFEPMAILNFLALMGWSSRQKNDVIPLPQLLELFSIDRLTRGSCIVALEKLQFLNKHYLRERMTDPKQLEQIVAQMQKSLKEKYPNSVSRISDSEYVCRCLLLLHNRVRTLPEFVDLCGYFFEEPSQNTIQHRMPLATNVSVLLSRLLHEFQLCSWQPQVLQTMVSDVASSFGIPLGKLQSLIRQILCGSVPGANLADTIHLLGRDTTLHRLEAYNRTIS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.68
2 0.74
3 0.76
4 0.77
5 0.82
6 0.85
7 0.83
8 0.79
9 0.78
10 0.79
11 0.79
12 0.78
13 0.72
14 0.68
15 0.64
16 0.69
17 0.7
18 0.61
19 0.58
20 0.51
21 0.51
22 0.51
23 0.5
24 0.49
25 0.4
26 0.44
27 0.39
28 0.41
29 0.36
30 0.32
31 0.32
32 0.25
33 0.25
34 0.2
35 0.2
36 0.15
37 0.16
38 0.16
39 0.13
40 0.11
41 0.15
42 0.19
43 0.26
44 0.3
45 0.31
46 0.35
47 0.41
48 0.45
49 0.49
50 0.5
51 0.47
52 0.5
53 0.54
54 0.61
55 0.54
56 0.53
57 0.49
58 0.52
59 0.53
60 0.55
61 0.52
62 0.44
63 0.45
64 0.46
65 0.45
66 0.45
67 0.45
68 0.44
69 0.45
70 0.43
71 0.45
72 0.42
73 0.38
74 0.31
75 0.25
76 0.18
77 0.13
78 0.13
79 0.09
80 0.1
81 0.11
82 0.09
83 0.08
84 0.1
85 0.1
86 0.1
87 0.11
88 0.09
89 0.09
90 0.1
91 0.1
92 0.08
93 0.09
94 0.09
95 0.11
96 0.13
97 0.17
98 0.21
99 0.24
100 0.26
101 0.3
102 0.31
103 0.31
104 0.3
105 0.3
106 0.3
107 0.34
108 0.32
109 0.27
110 0.26
111 0.22
112 0.22
113 0.2
114 0.18
115 0.13
116 0.21
117 0.23
118 0.3
119 0.31
120 0.31
121 0.3
122 0.32
123 0.33
124 0.29
125 0.28
126 0.27
127 0.34
128 0.34
129 0.4
130 0.39
131 0.41
132 0.44
133 0.51
134 0.48
135 0.48
136 0.54
137 0.52
138 0.58
139 0.55
140 0.5
141 0.44
142 0.44
143 0.41
144 0.34
145 0.35
146 0.26
147 0.26
148 0.23
149 0.23
150 0.21
151 0.16
152 0.15
153 0.11
154 0.11
155 0.1
156 0.12
157 0.09
158 0.13
159 0.19
160 0.22
161 0.3
162 0.36
163 0.41
164 0.44
165 0.46
166 0.45
167 0.45
168 0.43
169 0.36
170 0.3
171 0.27
172 0.23
173 0.21
174 0.19
175 0.14
176 0.11
177 0.1
178 0.11
179 0.09
180 0.1
181 0.11
182 0.12
183 0.14
184 0.15
185 0.14
186 0.13
187 0.15
188 0.14
189 0.14
190 0.12
191 0.1
192 0.09
193 0.09
194 0.09
195 0.05
196 0.05
197 0.04
198 0.05
199 0.05
200 0.05
201 0.05
202 0.05
203 0.07
204 0.07
205 0.08
206 0.09
207 0.11
208 0.11
209 0.15
210 0.17
211 0.2
212 0.23
213 0.23
214 0.26
215 0.31
216 0.37
217 0.38
218 0.46
219 0.42
220 0.41
221 0.46
222 0.42
223 0.38
224 0.36
225 0.39
226 0.34
227 0.35
228 0.35
229 0.3
230 0.3
231 0.29
232 0.31
233 0.24
234 0.2
235 0.18
236 0.18
237 0.17
238 0.18
239 0.21
240 0.2
241 0.27
242 0.3
243 0.34
244 0.37
245 0.43
246 0.48
247 0.46
248 0.43
249 0.36
250 0.33
251 0.31
252 0.29
253 0.21
254 0.15
255 0.13
256 0.11
257 0.1
258 0.09
259 0.08
260 0.06
261 0.07
262 0.07
263 0.06
264 0.05
265 0.05
266 0.05
267 0.04
268 0.03
269 0.03
270 0.03
271 0.05
272 0.08
273 0.1
274 0.1
275 0.12
276 0.14
277 0.15
278 0.19
279 0.23
280 0.23
281 0.23
282 0.23
283 0.23
284 0.23
285 0.21
286 0.17
287 0.12
288 0.1
289 0.09
290 0.08
291 0.08
292 0.07
293 0.08
294 0.08
295 0.08
296 0.08
297 0.08
298 0.08
299 0.08
300 0.09
301 0.1
302 0.1
303 0.11
304 0.11
305 0.12
306 0.12
307 0.13
308 0.13
309 0.14
310 0.24
311 0.24
312 0.3
313 0.32
314 0.38
315 0.38
316 0.41
317 0.44
318 0.43
319 0.46
320 0.47
321 0.46
322 0.44
323 0.45
324 0.41
325 0.37
326 0.27
327 0.26
328 0.25
329 0.25
330 0.2
331 0.21
332 0.21
333 0.25
334 0.28
335 0.28
336 0.27
337 0.34
338 0.35
339 0.4
340 0.49
341 0.5
342 0.52
343 0.55
344 0.51
345 0.46
346 0.47
347 0.42
348 0.37
349 0.33
350 0.35
351 0.31
352 0.33
353 0.29
354 0.26
355 0.23
356 0.19
357 0.24
358 0.26
359 0.32
360 0.36
361 0.41
362 0.42
363 0.43
364 0.45
365 0.4
366 0.37
367 0.29
368 0.26
369 0.22
370 0.21
371 0.26
372 0.23
373 0.22
374 0.17
375 0.17
376 0.13
377 0.13
378 0.16
379 0.13
380 0.13
381 0.18
382 0.2
383 0.21
384 0.23
385 0.28
386 0.28
387 0.29
388 0.3
389 0.26
390 0.25
391 0.27
392 0.29
393 0.24
394 0.22
395 0.19
396 0.18
397 0.16
398 0.15
399 0.13
400 0.1
401 0.1
402 0.12
403 0.12
404 0.12
405 0.13
406 0.13
407 0.12
408 0.22
409 0.21
410 0.22
411 0.22
412 0.22
413 0.22
414 0.25
415 0.28
416 0.19
417 0.19
418 0.17
419 0.18
420 0.17
421 0.16
422 0.13
423 0.1
424 0.1
425 0.09
426 0.09
427 0.06
428 0.08
429 0.08
430 0.08
431 0.1
432 0.13
433 0.13
434 0.15
435 0.15
436 0.2
437 0.25
438 0.29
439 0.27
440 0.25
441 0.25
442 0.26
443 0.26
444 0.2
445 0.16
446 0.14
447 0.14
448 0.14
449 0.15
450 0.12
451 0.12
452 0.11
453 0.11
454 0.09
455 0.1
456 0.1
457 0.09
458 0.1
459 0.11
460 0.12
461 0.14
462 0.16
463 0.22
464 0.22
465 0.23
466 0.24
467 0.27
468 0.32
469 0.37