Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

S9VNJ6

Protein Details
Accession S9VNJ6   
Localization Confidence Medium
Confidence Score 10.2
NoLS Segment(s)
PositionSequenceProtein Nature
96-126QAQPIEKVARQQRKQRKNRGKKVFGTGKRLAHydrophilic
NLS Segment(s)
PositionSequence
104-132ARQQRKQRKNRGKKVFGTGKRLAKRRAKS
Subcellular Location(s) mito 16, nucl 6, cyto 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR012678  Ribosomal_L23/L15e_core_dom_sf  
IPR001976  Ribosomal_S24e  
IPR018098  Ribosomal_S24e_CS  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01282  Ribosomal_S24e  
PROSITE View protein in PROSITE  
PS00529  RIBOSOMAL_S24E  
Amino Acid Sequences MSEAVTIRTRKFMTNRLLQRKQMVVDILHPGKANLSKNELREKLAQMYKTDAENITAFGLRTQFGGGRSTGFALIYDSNEALKKFEPHYRLVRVGQAQPIEKVARQQRKQRKNRGKKVFGTGKRLAKRRAKSQD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.53
2 0.62
3 0.66
4 0.71
5 0.69
6 0.69
7 0.64
8 0.57
9 0.51
10 0.43
11 0.33
12 0.3
13 0.34
14 0.29
15 0.27
16 0.25
17 0.22
18 0.22
19 0.26
20 0.27
21 0.21
22 0.27
23 0.29
24 0.33
25 0.42
26 0.4
27 0.39
28 0.39
29 0.39
30 0.39
31 0.4
32 0.38
33 0.3
34 0.32
35 0.3
36 0.27
37 0.26
38 0.19
39 0.16
40 0.15
41 0.14
42 0.11
43 0.1
44 0.1
45 0.09
46 0.09
47 0.07
48 0.07
49 0.07
50 0.08
51 0.08
52 0.09
53 0.09
54 0.09
55 0.09
56 0.09
57 0.09
58 0.07
59 0.07
60 0.07
61 0.07
62 0.07
63 0.07
64 0.07
65 0.08
66 0.09
67 0.09
68 0.09
69 0.1
70 0.12
71 0.14
72 0.19
73 0.22
74 0.25
75 0.32
76 0.35
77 0.37
78 0.36
79 0.38
80 0.37
81 0.36
82 0.35
83 0.32
84 0.29
85 0.26
86 0.28
87 0.25
88 0.21
89 0.26
90 0.32
91 0.39
92 0.45
93 0.55
94 0.62
95 0.72
96 0.82
97 0.86
98 0.88
99 0.89
100 0.93
101 0.94
102 0.92
103 0.88
104 0.88
105 0.88
106 0.83
107 0.81
108 0.78
109 0.77
110 0.76
111 0.77
112 0.76
113 0.75
114 0.76