Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

S9VWY9

Protein Details
Accession S9VWY9    Localization Confidence Medium Confidence Score 10.9
NoLS Segment(s)
PositionSequenceProtein Nature
15-40VPKPFRNPNYKAQSRRNRNLKQTLQSHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 23, cyto_nucl 16
Family & Domain DBs
InterPro View protein in InterPro  
IPR029525  INO80C/Ies6  
IPR013272  Vps72/YL1_C  
Gene Ontology GO:0031011  C:Ino80 complex  
GO:0034080  P:CENP-A containing chromatin assembly  
Pfam View protein in Pfam  
PF08265  YL1_C  
Amino Acid Sequences MEKPATVEDLDISLVPKPFRNPNYKAQSRRNRNLKQTLQSDPIQNDPTKLSYSSIEAPPSVLPQPKYCDVTGLPAPYTDPKTRLRYHNKEIYGLIRELPSGVDQEYLKLRSSDIVLKYLEMINIGD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.14
2 0.14
3 0.16
4 0.2
5 0.28
6 0.35
7 0.42
8 0.45
9 0.52
10 0.62
11 0.68
12 0.73
13 0.75
14 0.79
15 0.8
16 0.85
17 0.86
18 0.83
19 0.84
20 0.85
21 0.82
22 0.79
23 0.73
24 0.68
25 0.62
26 0.56
27 0.51
28 0.42
29 0.39
30 0.34
31 0.3
32 0.26
33 0.22
34 0.22
35 0.19
36 0.18
37 0.15
38 0.13
39 0.15
40 0.17
41 0.17
42 0.16
43 0.15
44 0.15
45 0.14
46 0.15
47 0.14
48 0.13
49 0.13
50 0.14
51 0.18
52 0.2
53 0.23
54 0.21
55 0.21
56 0.18
57 0.21
58 0.22
59 0.19
60 0.16
61 0.14
62 0.15
63 0.16
64 0.2
65 0.18
66 0.19
67 0.24
68 0.31
69 0.36
70 0.45
71 0.52
72 0.56
73 0.62
74 0.67
75 0.62
76 0.58
77 0.55
78 0.49
79 0.43
80 0.35
81 0.28
82 0.2
83 0.19
84 0.16
85 0.15
86 0.12
87 0.1
88 0.09
89 0.11
90 0.11
91 0.13
92 0.18
93 0.19
94 0.19
95 0.18
96 0.18
97 0.17
98 0.21
99 0.25
100 0.23
101 0.25
102 0.24
103 0.24
104 0.26
105 0.25
106 0.22