Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

S9X2W8

Protein Details
Accession S9X2W8   
Localization Confidence Medium
Confidence Score 10.5
NoLS Segment(s)
PositionSequenceProtein Nature
45-64SPFFQKEKNSPLKRNTPSSFHydrophilic
67-91QGSFTPSSTKKPRASKRDVRPLAERHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto_nucl 15, nucl 14.5, cyto 12.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR003593  AAA+_ATPase  
IPR032423  AAA_assoc_2  
IPR003959  ATPase_AAA_core  
IPR008921  DNA_pol3_clamp-load_cplx_C  
IPR021886  MgsA_C  
IPR027417  P-loop_NTPase  
Gene Ontology GO:0005524  F:ATP binding  
GO:0016887  F:ATP hydrolysis activity  
GO:0003677  F:DNA binding  
GO:0008047  F:enzyme activator activity  
GO:0017116  F:single-stranded DNA helicase activity  
GO:0033567  P:DNA replication, Okazaki fragment processing  
GO:0006282  P:regulation of DNA repair  
GO:0070914  P:UV-damage excision repair  
Pfam View protein in Pfam  
PF00004  AAA  
PF16193  AAA_assoc_2  
PF12002  MgsA_C  
CDD cd00009  AAA  
cd18139  HLD_clamp_RarA  
Amino Acid Sequences MLKKEEGQKCNCPTCGKEVDLVDINAHLDSHFEVPATSSPSKQVSPFFQKEKNSPLKRNTPSSFPSQGSFTPSSTKKPRASKRDVRPLAERARPTTLDDYVGQEELVGPRGVIRNMIEQDECPSMILWGNSGTGKTTLARIIAATTKSRFLEVSATSISVQECRKIFEESQNHLRLTGSKTIVFLDEVHRFNRAQQDIFLPLVEKGSITLIGATTENPSFRLNSALISRCPVFVLKKLDKTHVLKILEHGCQLEKDRLGDIPNIDSSILEYVSAITDGDARMALNCLEMAIGLMRQGPITLEEIKEKLVRSSAVYDRVGDAHYDTISAFHKSVRGCDVNASLYYLGRMLESGEDPLYVARRMVRIASEDIGVADNSMLPLASSAFTSVQQVGMPEADVILAHCAVALTMAPKSVDVYKGYNNVKRFLSLNPNAGRAEIPLHIRNAPTNLMKQLGYHKGYKYNPDYKDGLVKQEYMPESIRDAKFFRLPAELLEDEDLEK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.58
2 0.58
3 0.5
4 0.47
5 0.41
6 0.43
7 0.41
8 0.39
9 0.31
10 0.25
11 0.24
12 0.18
13 0.17
14 0.11
15 0.09
16 0.1
17 0.11
18 0.11
19 0.1
20 0.1
21 0.12
22 0.16
23 0.21
24 0.21
25 0.2
26 0.24
27 0.28
28 0.3
29 0.31
30 0.33
31 0.35
32 0.43
33 0.5
34 0.53
35 0.55
36 0.59
37 0.62
38 0.67
39 0.69
40 0.68
41 0.69
42 0.71
43 0.75
44 0.76
45 0.8
46 0.73
47 0.69
48 0.64
49 0.63
50 0.6
51 0.52
52 0.47
53 0.4
54 0.39
55 0.38
56 0.37
57 0.3
58 0.32
59 0.33
60 0.4
61 0.44
62 0.52
63 0.53
64 0.61
65 0.7
66 0.72
67 0.8
68 0.82
69 0.84
70 0.87
71 0.85
72 0.8
73 0.76
74 0.75
75 0.73
76 0.69
77 0.62
78 0.55
79 0.54
80 0.5
81 0.48
82 0.43
83 0.36
84 0.32
85 0.3
86 0.29
87 0.25
88 0.25
89 0.2
90 0.15
91 0.15
92 0.13
93 0.15
94 0.1
95 0.08
96 0.11
97 0.14
98 0.14
99 0.15
100 0.15
101 0.2
102 0.21
103 0.24
104 0.22
105 0.19
106 0.23
107 0.22
108 0.21
109 0.15
110 0.13
111 0.11
112 0.12
113 0.12
114 0.09
115 0.08
116 0.1
117 0.1
118 0.1
119 0.1
120 0.09
121 0.1
122 0.1
123 0.11
124 0.11
125 0.11
126 0.11
127 0.1
128 0.12
129 0.14
130 0.16
131 0.17
132 0.17
133 0.2
134 0.2
135 0.21
136 0.19
137 0.16
138 0.19
139 0.17
140 0.19
141 0.16
142 0.17
143 0.16
144 0.17
145 0.16
146 0.15
147 0.15
148 0.16
149 0.16
150 0.18
151 0.2
152 0.22
153 0.24
154 0.29
155 0.35
156 0.37
157 0.45
158 0.46
159 0.45
160 0.41
161 0.4
162 0.34
163 0.31
164 0.32
165 0.25
166 0.21
167 0.22
168 0.22
169 0.22
170 0.2
171 0.17
172 0.15
173 0.19
174 0.2
175 0.2
176 0.21
177 0.2
178 0.22
179 0.29
180 0.27
181 0.22
182 0.21
183 0.23
184 0.24
185 0.24
186 0.21
187 0.14
188 0.12
189 0.11
190 0.1
191 0.07
192 0.05
193 0.06
194 0.06
195 0.05
196 0.05
197 0.05
198 0.05
199 0.06
200 0.06
201 0.07
202 0.08
203 0.08
204 0.09
205 0.09
206 0.09
207 0.09
208 0.12
209 0.1
210 0.11
211 0.15
212 0.16
213 0.16
214 0.17
215 0.18
216 0.15
217 0.15
218 0.15
219 0.13
220 0.15
221 0.24
222 0.25
223 0.32
224 0.33
225 0.36
226 0.41
227 0.43
228 0.43
229 0.41
230 0.39
231 0.32
232 0.34
233 0.36
234 0.3
235 0.27
236 0.22
237 0.16
238 0.16
239 0.17
240 0.16
241 0.12
242 0.12
243 0.12
244 0.13
245 0.14
246 0.14
247 0.13
248 0.12
249 0.11
250 0.11
251 0.1
252 0.09
253 0.08
254 0.07
255 0.06
256 0.05
257 0.05
258 0.04
259 0.05
260 0.05
261 0.04
262 0.03
263 0.04
264 0.04
265 0.05
266 0.05
267 0.04
268 0.05
269 0.05
270 0.05
271 0.04
272 0.04
273 0.04
274 0.04
275 0.04
276 0.04
277 0.03
278 0.03
279 0.03
280 0.04
281 0.04
282 0.04
283 0.05
284 0.05
285 0.06
286 0.08
287 0.09
288 0.1
289 0.11
290 0.12
291 0.14
292 0.15
293 0.15
294 0.13
295 0.13
296 0.13
297 0.13
298 0.18
299 0.2
300 0.23
301 0.23
302 0.23
303 0.22
304 0.22
305 0.21
306 0.16
307 0.13
308 0.09
309 0.09
310 0.08
311 0.08
312 0.09
313 0.1
314 0.11
315 0.1
316 0.1
317 0.14
318 0.14
319 0.16
320 0.2
321 0.2
322 0.19
323 0.21
324 0.23
325 0.21
326 0.21
327 0.21
328 0.15
329 0.13
330 0.13
331 0.11
332 0.09
333 0.07
334 0.07
335 0.06
336 0.07
337 0.07
338 0.08
339 0.08
340 0.08
341 0.08
342 0.09
343 0.1
344 0.09
345 0.09
346 0.1
347 0.11
348 0.12
349 0.13
350 0.13
351 0.15
352 0.17
353 0.17
354 0.16
355 0.15
356 0.14
357 0.14
358 0.12
359 0.09
360 0.07
361 0.06
362 0.05
363 0.05
364 0.04
365 0.03
366 0.04
367 0.05
368 0.05
369 0.05
370 0.06
371 0.07
372 0.08
373 0.1
374 0.11
375 0.1
376 0.1
377 0.11
378 0.1
379 0.1
380 0.1
381 0.07
382 0.07
383 0.06
384 0.06
385 0.06
386 0.06
387 0.06
388 0.05
389 0.05
390 0.05
391 0.05
392 0.05
393 0.05
394 0.05
395 0.06
396 0.07
397 0.07
398 0.07
399 0.1
400 0.12
401 0.14
402 0.16
403 0.19
404 0.23
405 0.31
406 0.37
407 0.41
408 0.41
409 0.43
410 0.41
411 0.4
412 0.37
413 0.35
414 0.39
415 0.38
416 0.44
417 0.42
418 0.45
419 0.43
420 0.42
421 0.36
422 0.27
423 0.25
424 0.19
425 0.22
426 0.22
427 0.25
428 0.26
429 0.27
430 0.29
431 0.29
432 0.31
433 0.29
434 0.3
435 0.3
436 0.31
437 0.29
438 0.29
439 0.34
440 0.38
441 0.37
442 0.39
443 0.39
444 0.45
445 0.49
446 0.56
447 0.57
448 0.58
449 0.57
450 0.57
451 0.56
452 0.51
453 0.57
454 0.5
455 0.48
456 0.42
457 0.42
458 0.37
459 0.42
460 0.41
461 0.34
462 0.34
463 0.28
464 0.3
465 0.37
466 0.37
467 0.33
468 0.34
469 0.35
470 0.38
471 0.38
472 0.36
473 0.32
474 0.31
475 0.29
476 0.34
477 0.3
478 0.27
479 0.27