Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

S9XJ51

Protein Details
Accession S9XJ51   
Localization Confidence Medium
Confidence Score 10.3
NoLS Segment(s)
PositionSequenceProtein Nature
67-108NEYQPSNRKRKRKFGFLARIRSVNGRKILRNRRRKGRMYLTHHydrophilic
NLS Segment(s)
PositionSequence
74-103RKRKRKFGFLARIRSVNGRKILRNRRRKGR
Subcellular Location(s) mito 12.5, nucl 9.5, cyto_mito 8.833, cyto_nucl 7.333, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR000271  Ribosomal_L34  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00468  Ribosomal_L34  
Amino Acid Sequences MFFRSFQSFLPGARWSGLLNSFSMKKAQFLPTLQGSNGLGSGLLRSSFPAFDGIGMQQQVRWKTMGNEYQPSNRKRKRKFGFLARIRSVNGRKILRNRRRKGRMYLTH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.22
2 0.16
3 0.18
4 0.2
5 0.17
6 0.16
7 0.18
8 0.18
9 0.19
10 0.22
11 0.19
12 0.18
13 0.21
14 0.25
15 0.25
16 0.25
17 0.29
18 0.29
19 0.31
20 0.28
21 0.26
22 0.22
23 0.18
24 0.17
25 0.12
26 0.08
27 0.06
28 0.06
29 0.05
30 0.05
31 0.04
32 0.05
33 0.06
34 0.06
35 0.07
36 0.07
37 0.07
38 0.07
39 0.08
40 0.07
41 0.08
42 0.08
43 0.08
44 0.08
45 0.11
46 0.12
47 0.13
48 0.13
49 0.12
50 0.14
51 0.21
52 0.26
53 0.26
54 0.29
55 0.3
56 0.38
57 0.45
58 0.48
59 0.52
60 0.54
61 0.6
62 0.64
63 0.73
64 0.73
65 0.76
66 0.8
67 0.8
68 0.84
69 0.82
70 0.84
71 0.77
72 0.71
73 0.62
74 0.61
75 0.55
76 0.5
77 0.5
78 0.45
79 0.49
80 0.57
81 0.67
82 0.69
83 0.76
84 0.79
85 0.82
86 0.87
87 0.88
88 0.88