Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

S9XFP5

Protein Details
Accession S9XFP5    Localization Confidence Medium Confidence Score 10.4
NoLS Segment(s)
PositionSequenceProtein Nature
32-55QCPKVEKQEKPKQPKGRAHKRLVYBasic
NLS Segment(s)
PositionSequence
37-52EKQEKPKQPKGRAHKR
Subcellular Location(s) mito 11, nucl 8.5, cyto_nucl 8.5, cyto 7.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR006846  Ribosomal_S30  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF04758  Ribosomal_S30  
Amino Acid Sequences MLAGALHFHLTTTDNMGKVHGSLARAGKVKSQCPKVEKQEKPKQPKGRAHKRLVYVRRFVNVTNMAGGKRRMNPSS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.18
2 0.18
3 0.19
4 0.18
5 0.16
6 0.18
7 0.13
8 0.11
9 0.14
10 0.16
11 0.19
12 0.21
13 0.21
14 0.25
15 0.27
16 0.32
17 0.35
18 0.4
19 0.41
20 0.43
21 0.5
22 0.54
23 0.6
24 0.61
25 0.64
26 0.68
27 0.72
28 0.77
29 0.79
30 0.79
31 0.78
32 0.81
33 0.81
34 0.83
35 0.83
36 0.82
37 0.79
38 0.77
39 0.78
40 0.78
41 0.73
42 0.68
43 0.61
44 0.57
45 0.52
46 0.45
47 0.43
48 0.38
49 0.32
50 0.3
51 0.28
52 0.26
53 0.28
54 0.31
55 0.29
56 0.32