Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

S9W3I6

Protein Details
Accession S9W3I6   
Localization Confidence Low
Confidence Score 6.7
NoLS Segment(s)
PositionSequenceProtein Nature
1-26MAALKIVKKHTKPFRRHQSDRFHRVGHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 13.5, mito_nucl 10.5, cyto 7, nucl 6.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR001515  Ribosomal_L32e  
IPR018263  Ribosomal_L32e_CS  
IPR036351  Ribosomal_L32e_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01655  Ribosomal_L32e  
PROSITE View protein in PROSITE  
PS00580  RIBOSOMAL_L32E  
CDD cd00513  Ribosomal_L32_L32e  
Amino Acid Sequences MAALKIVKKHTKPFRRHQSDRFHRVGESWRKPRGIDNCVRRRFKGVIRMPKIGYGNNKKTRYCMPNGLKAFVVRNVADVDLLLMHNKTYAAEIASNVSARKRVEIVEKARALGVKVTNAGSKVRSQE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.82
2 0.84
3 0.87
4 0.86
5 0.87
6 0.87
7 0.87
8 0.8
9 0.7
10 0.6
11 0.54
12 0.55
13 0.54
14 0.54
15 0.53
16 0.54
17 0.54
18 0.54
19 0.58
20 0.56
21 0.54
22 0.53
23 0.56
24 0.61
25 0.68
26 0.71
27 0.64
28 0.62
29 0.58
30 0.54
31 0.54
32 0.53
33 0.54
34 0.56
35 0.59
36 0.54
37 0.54
38 0.5
39 0.43
40 0.43
41 0.41
42 0.46
43 0.51
44 0.54
45 0.5
46 0.51
47 0.55
48 0.51
49 0.46
50 0.46
51 0.4
52 0.45
53 0.46
54 0.45
55 0.38
56 0.34
57 0.31
58 0.24
59 0.22
60 0.14
61 0.14
62 0.13
63 0.12
64 0.11
65 0.1
66 0.08
67 0.06
68 0.06
69 0.06
70 0.05
71 0.05
72 0.05
73 0.06
74 0.06
75 0.06
76 0.07
77 0.07
78 0.08
79 0.08
80 0.1
81 0.11
82 0.12
83 0.12
84 0.12
85 0.15
86 0.15
87 0.16
88 0.16
89 0.17
90 0.25
91 0.32
92 0.37
93 0.42
94 0.43
95 0.41
96 0.42
97 0.4
98 0.33
99 0.3
100 0.27
101 0.2
102 0.21
103 0.23
104 0.23
105 0.24
106 0.25
107 0.22