Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

S9VUL6

Protein Details
Accession S9VUL6   
Localization Confidence Low
Confidence Score 5.8
NoLS Segment(s)
PositionSequenceProtein Nature
15-41LVKKDPWRLSHNRKYRLRQRLRAVDQVHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 20, cyto 3.5, cyto_nucl 3.5, nucl 2.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR016340  Ribosomal_L31_mit  
Gene Ontology GO:0005762  C:mitochondrial large ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
GO:0032543  P:mitochondrial translation  
Pfam View protein in Pfam  
PF09784  L31  
Amino Acid Sequences MFGPFRSTLARFGGLVKKDPWRLSHNRKYRLRQRLRAVDQVVDVLRSALSKQGQSVRAIEDFVATNPKESEMSPKDKYTVFTRKTQGAGPGGFRKSIHKVPKWTKITHRTNPEGF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.3
2 0.32
3 0.32
4 0.35
5 0.4
6 0.42
7 0.42
8 0.43
9 0.51
10 0.58
11 0.65
12 0.67
13 0.72
14 0.77
15 0.83
16 0.85
17 0.86
18 0.85
19 0.84
20 0.84
21 0.84
22 0.81
23 0.78
24 0.7
25 0.6
26 0.5
27 0.44
28 0.34
29 0.23
30 0.18
31 0.1
32 0.09
33 0.07
34 0.07
35 0.08
36 0.09
37 0.09
38 0.11
39 0.16
40 0.18
41 0.19
42 0.2
43 0.18
44 0.17
45 0.17
46 0.15
47 0.11
48 0.09
49 0.09
50 0.12
51 0.1
52 0.11
53 0.1
54 0.11
55 0.11
56 0.11
57 0.19
58 0.2
59 0.27
60 0.28
61 0.29
62 0.3
63 0.31
64 0.33
65 0.33
66 0.38
67 0.35
68 0.39
69 0.42
70 0.43
71 0.44
72 0.43
73 0.41
74 0.35
75 0.34
76 0.32
77 0.35
78 0.33
79 0.33
80 0.31
81 0.32
82 0.34
83 0.41
84 0.45
85 0.45
86 0.55
87 0.62
88 0.72
89 0.73
90 0.73
91 0.75
92 0.76
93 0.79
94 0.78
95 0.79