Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

S9W1X1

Protein Details
Accession S9W1X1   
Localization Confidence Low
Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
51-70LKEAKKRCPNDKAYRTFRSKHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 9, plas 8, cyto 3, E.R. 2, golg 2, cyto_pero 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR001708  YidC/ALB3/OXA1/COX18  
IPR028055  YidC/Oxa/ALB_C  
Gene Ontology GO:0005743  C:mitochondrial inner membrane  
GO:0032977  F:membrane insertase activity  
GO:0033617  P:mitochondrial cytochrome c oxidase assembly  
GO:0032979  P:protein insertion into mitochondrial inner membrane from matrix  
GO:0051204  P:protein insertion into mitochondrial membrane  
Pfam View protein in Pfam  
PF02096  60KD_IMP  
CDD cd20069  5TM_Oxa1-like  
Amino Acid Sequences MLQTLLSCHAYMPWCFEIPAMAIFLRSTITLPLAISSIKTGRKYAQVQPLLKEAKKRCPNDKAYRTFRSKIYKRFNCHPVMLYALPLTQIPLFALASFQLRKAVEVSPDTMSTEGMLWFPDLTMPDPHGILPAILACTYLTNMSILRRPQDSRLLRIFNTAGILSAFVVSFMASKTSTALSLYWTTSAIYSLAQNICLRNMFKQGDPRLVLRPKKVQPNHKNT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.23
2 0.23
3 0.23
4 0.2
5 0.19
6 0.19
7 0.15
8 0.11
9 0.11
10 0.11
11 0.11
12 0.1
13 0.09
14 0.09
15 0.08
16 0.09
17 0.09
18 0.1
19 0.1
20 0.1
21 0.1
22 0.09
23 0.11
24 0.15
25 0.19
26 0.2
27 0.22
28 0.24
29 0.32
30 0.37
31 0.42
32 0.47
33 0.5
34 0.51
35 0.51
36 0.56
37 0.54
38 0.5
39 0.51
40 0.46
41 0.49
42 0.56
43 0.59
44 0.6
45 0.64
46 0.72
47 0.75
48 0.8
49 0.78
50 0.78
51 0.8
52 0.78
53 0.72
54 0.68
55 0.68
56 0.66
57 0.66
58 0.69
59 0.69
60 0.69
61 0.74
62 0.74
63 0.68
64 0.62
65 0.53
66 0.43
67 0.4
68 0.33
69 0.26
70 0.19
71 0.15
72 0.13
73 0.11
74 0.11
75 0.06
76 0.06
77 0.05
78 0.06
79 0.06
80 0.05
81 0.06
82 0.05
83 0.08
84 0.08
85 0.08
86 0.1
87 0.1
88 0.11
89 0.13
90 0.13
91 0.13
92 0.14
93 0.16
94 0.13
95 0.14
96 0.13
97 0.12
98 0.1
99 0.09
100 0.08
101 0.06
102 0.05
103 0.05
104 0.05
105 0.04
106 0.04
107 0.05
108 0.05
109 0.07
110 0.07
111 0.08
112 0.08
113 0.09
114 0.09
115 0.09
116 0.08
117 0.06
118 0.06
119 0.05
120 0.05
121 0.05
122 0.05
123 0.05
124 0.05
125 0.05
126 0.05
127 0.05
128 0.05
129 0.06
130 0.08
131 0.12
132 0.13
133 0.15
134 0.18
135 0.2
136 0.23
137 0.32
138 0.34
139 0.36
140 0.41
141 0.42
142 0.38
143 0.4
144 0.37
145 0.27
146 0.26
147 0.2
148 0.14
149 0.11
150 0.11
151 0.07
152 0.07
153 0.07
154 0.05
155 0.05
156 0.04
157 0.05
158 0.05
159 0.06
160 0.06
161 0.06
162 0.08
163 0.08
164 0.09
165 0.09
166 0.09
167 0.11
168 0.13
169 0.14
170 0.13
171 0.13
172 0.13
173 0.12
174 0.13
175 0.1
176 0.09
177 0.08
178 0.13
179 0.13
180 0.16
181 0.17
182 0.17
183 0.19
184 0.22
185 0.23
186 0.2
187 0.28
188 0.28
189 0.3
190 0.39
191 0.42
192 0.46
193 0.48
194 0.48
195 0.49
196 0.55
197 0.58
198 0.56
199 0.61
200 0.61
201 0.69
202 0.75
203 0.77