Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

S9W0C5

Protein Details
Accession S9W0C5    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
295-320FLSVKFFAAQRRNRSNHRREMQQELYHydrophilic
NLS Segment(s)
Subcellular Location(s) plas 20, E.R. 4, mito 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR007577  GlycoTrfase_DXD_sugar-bd_CS  
IPR029044  Nucleotide-diphossugar_trans  
Gene Ontology GO:0033106  C:cis-Golgi network membrane  
GO:0032588  C:trans-Golgi network membrane  
GO:0016757  F:glycosyltransferase activity  
GO:0051999  P:mannosyl-inositol phosphorylceramide biosynthetic process  
Pfam View protein in Pfam  
PF04488  Gly_transf_sug  
Amino Acid Sequences MVRRTRKLFIVTISLLTFVFIFLKLSAYCQKYVYLLPNGKASTLHLNLQEMEASSGSSTSSQTKSKIPKIIHQIWKDENIPDKWSVSVNSCRTQHPEEDGWTVKLWTDEMALSFMETNYQWFMPIYHSYPYDIQRFDAVRYFIVYHYGGVYMDLDVGCKKSMDPLLDEATFLLPITDPIGYSNDWFAATPRHAFLYKVITSLSKFNHRYFTKYPTVLLSTGPLFFSFIFCQYLSESHSKVRTLPPALYGNGPVSFFSHVHGSSWHGSDASAYFWMQSHILYVFISIFVCILLLLFLSVKFFAAQRRNRSNHRREMQQELYP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.31
2 0.26
3 0.22
4 0.18
5 0.11
6 0.1
7 0.08
8 0.09
9 0.08
10 0.11
11 0.11
12 0.15
13 0.22
14 0.24
15 0.26
16 0.25
17 0.26
18 0.26
19 0.3
20 0.32
21 0.33
22 0.35
23 0.35
24 0.4
25 0.39
26 0.38
27 0.34
28 0.31
29 0.3
30 0.27
31 0.29
32 0.25
33 0.26
34 0.26
35 0.27
36 0.24
37 0.17
38 0.16
39 0.12
40 0.11
41 0.09
42 0.08
43 0.08
44 0.08
45 0.09
46 0.12
47 0.16
48 0.18
49 0.21
50 0.28
51 0.36
52 0.42
53 0.48
54 0.46
55 0.5
56 0.57
57 0.65
58 0.66
59 0.62
60 0.61
61 0.57
62 0.59
63 0.53
64 0.47
65 0.44
66 0.37
67 0.36
68 0.31
69 0.29
70 0.25
71 0.24
72 0.23
73 0.21
74 0.27
75 0.29
76 0.33
77 0.35
78 0.36
79 0.4
80 0.41
81 0.39
82 0.36
83 0.34
84 0.3
85 0.33
86 0.32
87 0.28
88 0.25
89 0.23
90 0.18
91 0.16
92 0.13
93 0.09
94 0.08
95 0.07
96 0.07
97 0.08
98 0.07
99 0.07
100 0.07
101 0.07
102 0.07
103 0.07
104 0.07
105 0.07
106 0.08
107 0.08
108 0.07
109 0.08
110 0.1
111 0.12
112 0.13
113 0.14
114 0.14
115 0.16
116 0.19
117 0.22
118 0.23
119 0.21
120 0.2
121 0.22
122 0.22
123 0.21
124 0.21
125 0.19
126 0.15
127 0.16
128 0.16
129 0.12
130 0.14
131 0.13
132 0.1
133 0.09
134 0.1
135 0.08
136 0.07
137 0.08
138 0.05
139 0.05
140 0.05
141 0.05
142 0.05
143 0.06
144 0.06
145 0.05
146 0.05
147 0.08
148 0.1
149 0.11
150 0.12
151 0.14
152 0.16
153 0.16
154 0.16
155 0.14
156 0.11
157 0.1
158 0.09
159 0.06
160 0.04
161 0.04
162 0.05
163 0.04
164 0.04
165 0.05
166 0.07
167 0.07
168 0.08
169 0.08
170 0.08
171 0.08
172 0.08
173 0.08
174 0.09
175 0.1
176 0.11
177 0.11
178 0.13
179 0.13
180 0.14
181 0.15
182 0.19
183 0.18
184 0.17
185 0.17
186 0.16
187 0.17
188 0.21
189 0.22
190 0.24
191 0.27
192 0.28
193 0.37
194 0.37
195 0.42
196 0.41
197 0.46
198 0.44
199 0.42
200 0.41
201 0.34
202 0.36
203 0.3
204 0.26
205 0.21
206 0.15
207 0.15
208 0.14
209 0.12
210 0.1
211 0.1
212 0.12
213 0.11
214 0.11
215 0.12
216 0.12
217 0.13
218 0.13
219 0.14
220 0.16
221 0.18
222 0.18
223 0.2
224 0.23
225 0.23
226 0.25
227 0.29
228 0.32
229 0.31
230 0.31
231 0.32
232 0.33
233 0.33
234 0.32
235 0.28
236 0.23
237 0.22
238 0.21
239 0.16
240 0.14
241 0.16
242 0.15
243 0.14
244 0.16
245 0.15
246 0.15
247 0.16
248 0.19
249 0.19
250 0.2
251 0.19
252 0.16
253 0.15
254 0.16
255 0.16
256 0.13
257 0.12
258 0.1
259 0.1
260 0.1
261 0.12
262 0.11
263 0.1
264 0.1
265 0.09
266 0.1
267 0.09
268 0.1
269 0.09
270 0.09
271 0.09
272 0.07
273 0.06
274 0.06
275 0.06
276 0.05
277 0.04
278 0.04
279 0.03
280 0.04
281 0.05
282 0.05
283 0.06
284 0.07
285 0.07
286 0.08
287 0.1
288 0.18
289 0.27
290 0.36
291 0.45
292 0.55
293 0.62
294 0.71
295 0.81
296 0.82
297 0.84
298 0.83
299 0.83
300 0.77
301 0.8