Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

S9XI06

Protein Details
Accession S9XI06    Localization Confidence High Confidence Score 16.4
NoLS Segment(s)
PositionSequenceProtein Nature
3-38FVGGSLKLKNVKKKPLKKKKKSSKKLSEKIEKHTAAHydrophilic
78-97EKRLLEKARKERFKTHKDKVBasic
NLS Segment(s)
PositionSequence
9-31KLKNVKKKPLKKKKKSSKKLSEK
Subcellular Location(s) nucl 24.5, cyto_nucl 13.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR013865  FAM32A  
Pfam View protein in Pfam  
PF08555  FAM32A  
Amino Acid Sequences MDFVGGSLKLKNVKKKPLKKKKKSSKKLSEKIEKHTAAENDDSKEGDPSDYQMLRISETQEEARSPTEAERQFEAIQEKRLLEKARKERFKTHKDKVDDYNRLLDSQSEHFEMPKIGPG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.63
2 0.73
3 0.81
4 0.85
5 0.91
6 0.92
7 0.95
8 0.95
9 0.96
10 0.96
11 0.96
12 0.96
13 0.96
14 0.94
15 0.93
16 0.92
17 0.85
18 0.82
19 0.8
20 0.7
21 0.6
22 0.57
23 0.48
24 0.4
25 0.39
26 0.34
27 0.26
28 0.26
29 0.24
30 0.19
31 0.18
32 0.16
33 0.12
34 0.1
35 0.1
36 0.13
37 0.13
38 0.13
39 0.14
40 0.14
41 0.15
42 0.15
43 0.15
44 0.11
45 0.13
46 0.13
47 0.11
48 0.11
49 0.11
50 0.11
51 0.1
52 0.1
53 0.1
54 0.16
55 0.18
56 0.19
57 0.2
58 0.22
59 0.22
60 0.23
61 0.27
62 0.21
63 0.23
64 0.23
65 0.22
66 0.21
67 0.25
68 0.27
69 0.27
70 0.35
71 0.42
72 0.51
73 0.59
74 0.62
75 0.68
76 0.75
77 0.8
78 0.8
79 0.79
80 0.78
81 0.76
82 0.76
83 0.76
84 0.76
85 0.72
86 0.65
87 0.63
88 0.55
89 0.49
90 0.44
91 0.36
92 0.29
93 0.27
94 0.28
95 0.22
96 0.22
97 0.22
98 0.23
99 0.23