Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

S9WZL3

Protein Details
Accession S9WZL3    Localization Confidence High Confidence Score 20
NoLS Segment(s)
PositionSequenceProtein Nature
1-34MVTPRQRKKQRSGQPRLTRRNHNKKAKAKIYGNAHydrophilic
NLS Segment(s)
PositionSequence
5-29RQRKKQRSGQPRLTRRNHNKKAKAK
149-156RKDKPRKK
Subcellular Location(s) nucl 25
Family & Domain DBs
InterPro View protein in InterPro  
IPR019002  Ribosome_biogenesis_Nop16  
Gene Ontology GO:0005730  C:nucleolus  
Pfam View protein in Pfam  
PF09420  Nop16  
Amino Acid Sequences MVTPRQRKKQRSGQPRLTRRNHNKKAKAKIYGNAIVRENWDMHATLTQNYERMGLVVTPNYVTGGKEKINPEPKLQKNEKNAEPTAEELEEVRRSLGPGQAIVRRDDEGNIIEIIHGKERTFDDILDEKVQSVPAKTEVTKKLEEEASRKDKPRKKLPLSAFELSYVSKLLNKYGTEDFESMAKDVKLNPKLLSSAKLKQMYSRMQT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.9
2 0.92
3 0.92
4 0.9
5 0.91
6 0.91
7 0.91
8 0.91
9 0.91
10 0.9
11 0.89
12 0.92
13 0.89
14 0.87
15 0.81
16 0.76
17 0.73
18 0.7
19 0.65
20 0.58
21 0.51
22 0.42
23 0.39
24 0.36
25 0.28
26 0.22
27 0.19
28 0.15
29 0.14
30 0.17
31 0.16
32 0.15
33 0.18
34 0.17
35 0.17
36 0.17
37 0.17
38 0.13
39 0.13
40 0.12
41 0.09
42 0.1
43 0.1
44 0.1
45 0.09
46 0.09
47 0.1
48 0.1
49 0.09
50 0.1
51 0.12
52 0.13
53 0.18
54 0.2
55 0.27
56 0.35
57 0.37
58 0.41
59 0.48
60 0.52
61 0.56
62 0.61
63 0.6
64 0.59
65 0.65
66 0.63
67 0.59
68 0.54
69 0.47
70 0.42
71 0.36
72 0.29
73 0.22
74 0.17
75 0.11
76 0.13
77 0.12
78 0.11
79 0.1
80 0.08
81 0.09
82 0.1
83 0.11
84 0.09
85 0.1
86 0.12
87 0.15
88 0.16
89 0.16
90 0.16
91 0.15
92 0.15
93 0.14
94 0.13
95 0.1
96 0.1
97 0.09
98 0.08
99 0.07
100 0.08
101 0.09
102 0.1
103 0.1
104 0.08
105 0.11
106 0.12
107 0.15
108 0.14
109 0.14
110 0.15
111 0.17
112 0.19
113 0.18
114 0.18
115 0.14
116 0.14
117 0.16
118 0.12
119 0.11
120 0.1
121 0.11
122 0.14
123 0.15
124 0.22
125 0.25
126 0.29
127 0.31
128 0.3
129 0.31
130 0.33
131 0.34
132 0.32
133 0.35
134 0.39
135 0.42
136 0.48
137 0.54
138 0.57
139 0.64
140 0.7
141 0.72
142 0.72
143 0.76
144 0.78
145 0.78
146 0.78
147 0.72
148 0.62
149 0.52
150 0.45
151 0.36
152 0.29
153 0.19
154 0.12
155 0.13
156 0.12
157 0.14
158 0.18
159 0.18
160 0.21
161 0.24
162 0.27
163 0.28
164 0.28
165 0.26
166 0.23
167 0.24
168 0.2
169 0.2
170 0.17
171 0.15
172 0.19
173 0.28
174 0.31
175 0.32
176 0.33
177 0.32
178 0.36
179 0.38
180 0.39
181 0.36
182 0.38
183 0.44
184 0.49
185 0.47
186 0.48
187 0.54