Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

S9XE72

Protein Details
Accession S9XE72    Localization Confidence Medium Confidence Score 14.2
NoLS Segment(s)
PositionSequenceProtein Nature
1-39MAQKRANQQKKPKSTSQGIKKRSKAKKDSKKSTKYQQNLHydrophilic
NLS Segment(s)
PositionSequence
9-31QKKPKSTSQGIKKRSKAKKDSKK
Subcellular Location(s) nucl 23, cyto_nucl 14
Family & Domain DBs
Amino Acid Sequences MAQKRANQQKKPKSTSQGIKKRSKAKKDSKKSTKYQQNLLLQNLDDYTTTQSVLRIAHNSNSNVDQVSNSIETLSMNKKQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.8
2 0.81
3 0.81
4 0.8
5 0.79
6 0.81
7 0.81
8 0.82
9 0.82
10 0.82
11 0.82
12 0.83
13 0.85
14 0.86
15 0.9
16 0.9
17 0.89
18 0.86
19 0.86
20 0.85
21 0.78
22 0.74
23 0.7
24 0.67
25 0.62
26 0.56
27 0.47
28 0.37
29 0.33
30 0.26
31 0.18
32 0.11
33 0.08
34 0.09
35 0.08
36 0.09
37 0.09
38 0.09
39 0.1
40 0.11
41 0.12
42 0.13
43 0.14
44 0.19
45 0.23
46 0.24
47 0.25
48 0.25
49 0.25
50 0.22
51 0.21
52 0.17
53 0.13
54 0.16
55 0.14
56 0.12
57 0.11
58 0.11
59 0.11
60 0.16